Prop. 2006/07:115

Ny lag om värdepappersmarknaden

1

Regeringen överlämnar denna proposition till riksdagen.

Stockholm den 26 april 2007

Fredrik Reinfeldt

Mats Odell

(Finansdepartementet)

Propositionens huvudsakliga innehåll

I propositionen föreslås en ny lag om värdepappersmarknaden. Den nya lagen innehåller bl.a. bestämmelser som behövs för att genomföra Europaparlamentets och rådets direktiv 2004/39/EG av den 21 april 2004 om marknader för finansiella instrument och om ändring av rådets direktiv 85/611/EEG och 93/6/EEG och Europaparlamentets och rådets direktiv 2000/12/EG samt upphävande av rådets direktiv 93/22/EEG.

Direktivet innebär en ökad harmonisering av reglerna för värdepappersföretagen och innehåller bestämmelser om reglering och tillsyn av sådana företag och om rätt för dessa att med stöd av sitt hemlandstillstånd bedriva gränsöverskridande verksamhet i andra medlemsstater. Värdepappersföretagen skall vara skyldiga att rapportera transaktioner avseende aktier upptagna till handel på en reglerad marknad till behörig myndighet. Genom direktivet harmoniseras också reglerna för reglerade marknader, dvs. i Sverige börser och auktoriserade marknadsplatser. Vidare finns bestämmelser om vilka krav som skall gälla för att ett finansiellt instrument skall tas upp till handel på en reglerad marknad och regler om tillträde till reglerade marknader.

Den föreslagna lagen om värdepappersmarknaden ersätter lagen (1991:981) om värdepappersrörelse och lagen (1992:543) om börs- och clearingverksamhet.

Finansinspektionen och Bolagsverket föreslås bli behöriga myndigheter på området.

Lagändringarna föreslås träda i kraft den 1 november 2007.

2

Innehållsförteckning

1 Förslag till riksdagsbeslut................................................................10

2 Lagtext .............................................................................................12 2.1 Förslag till lag om värdepappersmarknaden .....................12 2.2 Förslag till lag om ändring i föräldrabalken .....................89 2.3 Förslag till lag om ändring i kreditupplysningslagen (1973:1173).......................................................................91 2.4 Förslag till lag om ändring i sekretesslagen (1980:100)...92 2.5 Förslag till lag om ändring i försäkringsrörelselagen (1982:713).........................................................................94 2.6 Förslag till lag om ändring i konkurslagen (1987:672) ..108 2.7 Förslag till lag om ändring i lagen (1990:661) om avkastningsskatt på pensionsmedel.................................109 2.8 Förslag till lag om ändring i lagen (1991:980) om handel med finansiella instrument ..................................111 2.9 Förslag till lag om ändring i lagen (1992:160) om utländska filialer m.m. ....................................................139 2.10 Förslag till lag om ändring i konkurrenslagen (1993:20).........................................................................140 2.11 Förslag till lag om ändring i lagen (1993:768) om åtgärder mot penningtvätt ...............................................141 2.12 Förslag till lag om ändring i lagen (1993:931) om individuellt pensionssparande .........................................142 2.13 Förslag till lag om ändring i pantbankslagen (1995:1000).....................................................................144 2.14 Förslag till lag om ändring i årsredovisningslagen (1995:1554).....................................................................145 2.15 Förslag till lag om ändring i lagen (1995:1559) om årsredovisning i kreditinstitut och värdepappersbolag ...151 2.16 Förslag till lag om ändring i lagen (1995:1560) om årsredovisning i försäkringsföretag.................................154 2.17 Förslag till lag om ändring i lagen (1995:1571) om insättningsgaranti ............................................................156 2.18 Förslag till lag om ändring i lagen (1997:323) om statlig förmögenhetsskatt ................................................157 2.19 Förslag till lag om ändring i skattebetalningslagen (1997:483).......................................................................161 2.20 Förslag till lag om ändring i lagen (1998:710) med vissa bestämmelser om Premiepensionsmyndigheten ....163 2.21 Förslag till lag om ändring i lagen (1998:1479) om kontoföring av finansiella instrument .............................164 2.22 Förslag till lag om ändring i lagen (1998:1757) om förvaltning av vissa fonder inom socialförsäkrings- området ...........................................................................167 2.23 Förslag till lag om ändring i lagen (1999:158) om investerarskydd ...............................................................168 2.24 Förslag till lag om ändring i bokföringslagen (1999:1078).....................................................................169

3

2.25 Förslag till lag om ändring i inkomstskattelagen (1999:1229).....................................................................170 2.26 Förslag till lag om ändring i lagen (1999:1309) om system för avveckling av förpliktelser på finans- marknaden.......................................................................173 2.27 Förslag till lag om ändring i lagen (2000:35) om byte av redovisningsvaluta i finansiella företag .....................176 2.28 Förslag till lag om ändring i lagen (2000:192) om allmänna pensionsfonder (AP-fonder) ............................178 2.29 Förslag till lag om ändring i lagen (2000:193) om Sjätte AP-fonden .............................................................181 2.30 Förslag till lag om ändring i lagen (2000:562) om internationell rättslig hjälp i brottmål .............................182 2.31 Förslag till lag om ändring i lagen (2000:1087) om anmälningsskyldighet för vissa innehav av finansiella instrument .......................................................................183 2.32 Förslag till lag om ändring i lagen (2001:1227) om självdeklarationer och kontrolluppgifter.........................188 2.33 Förslag till lag om ändring i lagen (2003:862) om finansiell rådgivning till konsumenter ............................190 2.34 Förslag till lag om ändring i lagen (2003:1223) om utgivning av säkerställda obligationer ............................191 2.35 Förslag till lag om ändring i lagen (2004:46) om investeringsfonder...........................................................194 2.36 Förslag till lag om ändring i lagen (2004:297) om bank- och finansieringsrörelse ........................................202 2.37 Förslag till lag om ändring i lagen (2005:377) om straff för marknadsmissbruk vid handel med finansiella instrument .......................................................................206 2.38 Förslag till lag om ändring i lagen (2005:405) om försäkringsförmedling.....................................................209 2.39 Förslag till lag om ändring i aktiebolagslagen (2005:551).......................................................................212 2.40 Förslag till lag om ändring i lagen (2005:1047) om internationella förhållanden rörande försäkringsföretags och kreditinstituts insolvens............................................224 2.41 Förslag till lag om ändring i lagen (2006:451) om offentliga uppköpserbjudanden på aktiemarknaden .......225 2.42 Förslag till lag om ändring i lagen (2006:531) om särskild tillsyn över finansiella konglomerat ..................228 2.43 Förslag till lag om ändring i lagen (2006:1371) om kapitaltäckning och stora exponeringar ..........................231 2.44 Förslag till lag om ändring i lagen (2006:1372) om införande av lagen (2006:1371) om kapitaltäckning och stora exponeringar...........................................................237

3 Ärendet och dess beredning...........................................................239

4 Bakgrund .......................................................................................241 4.1 Direktivet om marknader för finansiella instrument (MiFID)...........................................................................241 4.2 Kommissionens genomförandebestämmelser.................242

4

4.3 ISD ..................................................................................243 4.4 Öppenhetsdirektivet ........................................................245 4.5 Hänvisningar till EG-rättsakter .......................................246 4.6 Gällande bestämmelser på värdepappersområdet...........247

5 Handeln med finansiella instrument i Sverige...............................249 5.1 Handeln med aktier .........................................................249 5.1.1 Aktiehandeln på Stockholmsbörsen .............249

5.1.2 Den nordiska börslistan ................................252 5.1.3 Annan börs ....................................................253 5.1.4 Auktoriserad marknadsplats .........................253 5.1.5 Annan organiserad handel ............................253 5.1.6 Handeln med aktierelaterade derivat ............254

5.2 Handeln med räntebärande instrument ...........................255 5.2.1 Handeln på obligations- och penningmarknaderna.....................................255 5.2.2 Handeln med derivatinstrument på räntemarknaden.............................................258 5.3 Värdepappersinstituten ...................................................259 5.4 Den finansiella elmarknaden...........................................261

6 Principer för finansiell reglering ...................................................264 6.1 Den finansiella sektorns funktioner ................................264 6.1.1 Grundläggande funktioner ............................264

6.1.2 Finansiella marknader och värdepappers- institut ...........................................................265

6.2 Motiv för reglering..........................................................266 6.2.1 Inledning .......................................................266 6.2.2 Behovet av systemskydd...............................266 6.2.3 Behovet av konsumentskydd ........................268 6.2.4 Behovet av effektivitet..................................269 6.3 Principiella överväganden i anslutning till MiFID .........270 6.3.1 Fragmentering...............................................270 6.3.2 Internalisering ...............................................271 6.3.3 Genomlysning...............................................271 6.4 Sammanfattande bedömning...........................................272

7 Några allmänna utgångspunkter ....................................................274 7.1 Behöriga myndigheter.....................................................274 7.2 Möjligheter att delegera vissa uppgifter till annan än den behöriga myndigheten ..............................................274 7.3 En ny lag .........................................................................275 7.4 Terminologi.....................................................................276 7.5 Förhållande mellan nationell reglering och gemenskapsregler m.m. ..................................................276

8 Tillämpningsområde......................................................................278 8.1 Finansiella instrument .....................................................278 8.1.1 Inledning .......................................................278

8.1.2 Finansiella instrument, överlåtbara värdepapper, fondandelar och penningmarknadsinstrument m.m.................278

8.2 Olika kundkategorier ......................................................290

5

8.2.1 Professionella kunder och icke- professionella kunder....................................290 8.2.2 Jämbördiga motparter ...................................297

8.3 Värdepappersrörelse .......................................................300 8.3.1 Investeringstjänster och investeringsverksamheter .............................300 8.3.2 Sidotjänster och sidoverksamheter ...............320 8.4 Reglerade marknader ......................................................328 8.5 Undantag från tillämpningsområdet för MiFID..............338 8.5.1 Undantagen i MiFID.....................................338 8.5.2 Undantag från tillämpningsområdet för den nya lagstiftningen...................................340

9 Tillståndskrav för svenska företag.................................................347 9.1 Värdepappersbolag .........................................................347 9.1.1 Grundläggande krav för tillstånd att driva värdepappersrörelse ......................................347

9.1.2 Krav på startkapital m.m., system för investerarskydd och regler om förvärv och innehav av egendom .....................................351 9.1.3 Krav på organisationen .................................362

9.2 Anknutna ombud.............................................................371 9.3 Reglerade marknader ......................................................379 9.3.1 Krav på tillstånd, ledande befattningshavare och ägare .......................................................379 9.3.2 Krav på organisationen m.m.........................380 9.4 Fondbolag .......................................................................384 9.4.1 Krav på kapital och investerarskydd.............384 9.4.2 Krav på organisationen .................................385

10 Verksamhet över gränserna ...........................................................388 10.1 Inledning .........................................................................388 10.2 Värdepappersföretag .......................................................388 10.3 Reglerade marknader ......................................................392

11 Genomlysning................................................................................395 11.1 Inledning .........................................................................395 11.2 Gällande rätt....................................................................395 11.3 Informationskrav på reglerade marknader och MTF:er..397 11.3.1 Information före och efter handel .................397

11.3.2 Bemyndiganden ............................................399

11.4 Informationskrav på värdepappersinstitut.......................403 11.4.1 Limitorder .....................................................403 11.4.2 Systematiska internhandlare .........................404 11.4.3 Information efter handel ...............................409 11.4.4 Bemyndiganden ............................................412

12 Transaktionsrapportering m.m. .....................................................415 12.1 Transaktionsrapportering ................................................415 12.1.1 Regler i MiFID om skyldighet att rapportera transaktioner..................................................415

12.1.2 Gällande rätt..................................................416 12.1.3 Genomförande av reglerna i MiFID .............417

6

12.2 Uppgifter om utförda transaktioner ................................429 12.2.1 Regler i MiFID om skyldighet att spara uppgifter om utförda transaktioner ...............429 12.2.2 Genomförande i svensk rätt ..........................430

13 Skydd för investerare.....................................................................432 13.1 Inledning .........................................................................432 13.1.1 Bakgrund till reglerna i MiFID om skydd för investerare ...............................................432

13.1.2 Gällande rätt..................................................432 13.1.3 Kommissionslagen........................................433

13.2 Sundhets- och uppföranderegler .....................................434 13.2.1 Allmänna sundhetskrav och krav på information till kunder ..................................434 13.2.2 Inhämtande av uppgifter vid investeringsrådgivning och portfölj- förvaltning.....................................................437 13.2.3 Prövning av om en investeringstjänst eller produkt passar en kund .................................441 13.2.4 Dokumentation och rapportering ..................444 13.2.5 Undantag från prövning av om en investeringstjänst passar en kund och från informationskrav...........................................446 13.2.6 Intressekonflikter ..........................................447 13.3 Tillhandahållande av tjänster via ett annat företag .........450 13.4 Bästa orderutförande och hantering av kunders order ....451 13.4.1 Bästa utförande av kundorder .......................451 13.4.2 Hantering av kundorder i övrigt ...................456 13.5 Fondbolag .......................................................................458

14 Marknadsplatser ............................................................................461 14.1 Inledning .........................................................................461 14.2 Upptagande av instrument till handel (noteringsregler) – reglerade marknader.....................................................461 14.3 Finansiella instrument som handlas på MTF ..................468 14.4 Tillträde och deltagande – reglerad marknad..................471 14.5 Tillträde till MTF ............................................................474 14.6 Principerna om fritt tillträde och neutralitet beträffande reglerade marknader........................................................475 14.7 Marknadsövervakning, handelsstopp m.m. ....................478 14.7.1 Marknadsövervakning på en reglerad marknad och MTF ........................................478

14.7.2 Handelsstopp på en reglerad marknad m.m..480 14.7.3 Handelsstopp på en MTF..............................483 14.7.4 Funktioner för avveckling av affärerna ........484

15 Tillsyn och kontroll- och ingripandemöjligheter...........................485 15.1 Inledning .........................................................................485 15.2 Tillsyn .............................................................................485 15.3 Finansinspektionens kontroll- och ingripande- möjligheter enligt gällande rätt .......................................488 15.4 Behovet av ändrade regler ..............................................490 15.4.1 Kontrollmöjligheter ......................................491

7

15.4.2 Ingripanden ...................................................497 15.4.2.1 Grundläggande bestämmelser om

ingripande .....................................................497

15.4.2.2 Ingripanden i särskilda fall ...........................501 15.4.2.3 Straffavgift....................................................507 15.4.2.4 Förseningsavgift............................................509 15.4.2.5 Särskilt om anknutna ombud ........................510 15.4.2.6 Ingripande mot utländska företag .................511

15.5 Rätt att offentliggöra åtgärd eller sanktion .....................512 15.6 Civilrättsliga sanktioner ..................................................513

16 Samarbete mellan behöriga myndigheter ......................................515 16.1 Samarbete och informationsutbyte .................................515 16.2 Samråd inför auktorisation..............................................517 16.3 Värdmedlemsstatens befogenheter .................................518 16.4 Försiktighetsåtgärder som värdmedlemsstaten är skyldig att vidta...............................................................518 16.5 Förhållandet till revisorer................................................521

17 Prövningsförfaranden m.m. ...........................................................522 17.1 Överklaganden m.m. .......................................................522 17.2 Hantering av klagomål och tvistlösning .........................525 18 Ekonomiska konsekvenser m.m. ...................................................528 18.1 Inledning .........................................................................528 18.2 Konsekvenser för värdepappersmarknadens funktion ....529 18.2.1 Värdepappersinstituten .................................529

18.2.2 Marknadsplatserna ........................................533 18.2.3 Investerarna...................................................533

18.3 Konsekvenser för Finansinspektionen ............................534 18.4 Konsekvenser för Bolagsverket ......................................534 18.5 Konsekvenser för domstolarna .......................................535 18.6 Konsekvenser för småföretagen......................................536

19 Ikraftträdande- och övergångsbestämmelser.................................537 19.1 Inledning .........................................................................537 19.2 Ikraftträdande ..................................................................537 19.3 Tillstånd ..........................................................................537 19.4 Andra övergångsregler i MiFID......................................547 19.5 Upptagande till handel ....................................................548 20 Författningskommentar .................................................................550 20.1 Förslag till lag om värdepappersmarknaden ...................550 20.2 Andra författningsförslag................................................650 20.2.1 Inledning .......................................................650

20.2.2 Förslag till lag om ändring i sekretesslagen (1980:100).....................................................650 20.2.3 Förslag till lag om ändring i försäkringsrörelselagen (1982:713) ..............651 20.2.4 Förslag till lag om ändring i konkurslagen (1987:672).....................................................652 20.2.5 Förslag till lag om ändring av lagen (1990:661) om avkastningsskatt på pensionsmedel...............................................652

8

20.2.6 Förslag till lag om ändring i lagen (1991:980) om handel med finansiella instrument .....................................................653 20.2.7 Förslag till lag om ändring i konkurrens- lagen (1993:20) .............................................656 20.2.8 Förslag till lag om ändring i lagen (1993:931) om individuellt pensions- sparande ........................................................656 20.2.9 Förslag till lag om ändring i pantbankslagen (1995:1000)...................................................658 20.2.10 Förslag till lag om ändring i årsredovisningslagen (1995:1554)................658 20.2.11 Förslag till lag om ändring i lagen (1995:1559) om årsredovisning i kreditinstitut och värdepappersbolag ............659 20.2.12 Förslag till lag om ändring i lagen (1995:1560) om årsredovisning i försäkringsföretag .........................................660 20.2.13 Förslag till lag om ändring i lagen (1995:1571) om insättningsgaranti ...............660 20.2.14 Förslag till lag om ändring i lagen (1997:323) om statlig förmögenhetsskatt .....660 20.2.15 Förslag till lag om ändring i skattebetalningslagen (1997:483) .................661 20.2.16 Förslag till lag om ändring i lagen (1998:710) med vissa bestämmelser om Premiepensionsmyndigheten ........................661 20.2.17 Förslag till lag om ändring i lagen (1998:1479) om kontoföring av finansiella instrument .....................................................661 20.2.18 Förslag till lag om ändring i lagen (1998:1757) om förvaltning av vissa fonder inom socialförsäkringsområdet.....................662 20.2.19 Förslag till lag om ändring i lagen (1999:158) om investerarskydd ....................662 20.2.20 Förslag till lag om ändring i inkomstskatte- lagen (1999:1229) .........................................663 20.2.21 Förslag till lag om ändring i lagen (1999:1309) om system för avveckling av förpliktelser på finansmarknaden .................665 20.2.22 Förslag till lag om ändring i lagen (2000:35) om byte av redovisningsvaluta i finansiella företag ...........................................................665 20.2.23 Förslag till lag om ändring i lagen (2000:192) om allmänna pensionsfonder (AP-fonder) ...................................................666 20.2.24 Förslag till lag om ändring i lagen (2000:193) om Sjätte AP-fonden..................666 20.2.25 Förslag till lag om ändring i lagen (2000:1087) om anmälningsskyldighet för vissa innehav av finansiella instrument ........667

9

20.2.26 Förslag till lag om ändring i lagen (2001:1227) om självdeklarationer och kontrolluppgifter ...........................................669 20.2.27 Förslag till lag om ändring i lagen (2003:862) om finansiell rådgivning till konsumenter..................................................670 20.2.28 Förslag till lag om ändring i lagen (2004:46) om investeringsfonder..................671 20.2.29 Förslag till lag om ändring i lagen (2004:297) om bank- och finansierings- rörelse............................................................675 20.2.30 Förslag till lag om ändring i lagen (2005:377) om straff för marknadsmissbruk vid handel med finansiella instrument ..........675 20.2.31 Förslag till lag om ändring i lagen (2005:405) om försäkringsförmedling..........676 20.2.32 Förslag till lag om ändring i aktiebolags- lagen (2005:551) ...........................................677 20.2.33 Förslag till lag om ändring i lagen (2005:1047) om internationella förhållanden rörande försäkringsföretags och kredit- instituts insolvens..........................................679 20.2.34 Förslag till lag om ändring i lagen (2006:451) om offentliga uppköps- erbjudanden på aktiemarknaden ...................679 20.2.35 Förslag till lag om ändring i lagen (2006:531) om särskild tillsyn över finansiella konglomerat ................................680 20.2.36 Förslag till lag om ändring i lagen (2006:1371) om kapitaltäckning och stora exponeringar .................................................681 20.2.37 Förslag till lag om ändring i lagen (2006:1372) om införande av lagen (2006:1371) om kapitaltäckning och stora exponeringar .................................................681

Utdrag ur protokoll vid regeringssammanträde den 26 april 2007........683

10

1 Förslag till riksdagsbeslut

Regeringen föreslår att riksdagen antar regeringens förslag till

1. lag om värdepappersmarknaden,

2. lag om ändring i föräldrabalken,

3. lag om ändring i kreditupplysningslagen (1973:1173),

4. lag om ändring i sekretesslagen (1980:100),

5. lag om ändring i försäkringsrörelselagen (1982:713),

6. lag om ändring i konkurslagen (1987:672),

7. lag om ändring i lagen (1990:661) om avkastningsskatt på pensionsmedel,

8. lag om ändring i lagen (1991:980) om handel med finansiella instrument,

9. lag om ändring i lagen (1992:160) om utländska filialer m.m. , 10. lag om ändring i konkurrenslagen (1993:20) , 11. lag om ändring i lagen (1993:768) om åtgärder mot penningtvätt, 12. lag om ändring i lagen (1993:931) om individuellt pensionssparande,

13. lag om ändring i pantbankslagen (1995:1000), 14. lag om ändring i årsredovisningslagen (1995:1554), 15. lag om ändring i lagen (1995:1559) om årsredovisning i kreditinstitut och värdepappersbolag,

16. lag om ändring i lagen (1995:1560) om årsredovisning i försäkringsföretag,

17. lag om ändring i lagen (1995:1571) om insättningsgaranti, 18. lag om ändring i lagen (1997:323) om statlig förmögenhetsskatt, 19. lag om ändring i skattebetalningslagen (1997:483), 20. lag om ändring i lagen (1998:710) med vissa bestämmelser om Premiepensionsmyndigheten,

21. lag om ändring i lagen (1998:1479) om kontoföring av finansiella instrument,

22. lag om ändring i lagen (1998:1757) om förvaltning av vissa fonder inom socialförsäkringsområdet,

23. lag om ändring i lagen (1999:158) om investerarskydd, 24. lag om ändring i bokföringslagen (1999:1078), 25. lag om ändring i inkomstskattelagen (1999:1229), 26. lag om ändring i lagen (1999:1309) om system för avveckling av förpliktelser på finansmarknaden,

27. lag om ändring i lagen (2000:35) om byte av redovisningsvaluta i finansiella företag,

28. lag om ändring i lagen (2000:192) om allmänna pensionsfonder (AP-fonder) ,

29. lag om ändring i lagen (2000:193) om sjätte AP-fonden, 30. lag om ändring i lagen (2000:562) om internationell rättslig hjälp i brottmål,

31. lag om ändring i lagen (2000:1087) om anmälningsskyldighet för vissa innehav av finansiella instrument ,

32. lag om ändring i lagen (2001:1227) om självdeklarationer och kontrolluppgifter,

33. lag om ändring i lagen (2003:862) om finansiell rådgivning till konsumenter,

11

34. lag om ändring i lagen (2003:1223) om utgivning av säkerställda obligationer,

35. lag om ändring i lagen (2004:46) om investeringsfonder, 36. lag om ändring i lagen (2004:297) om bank- och finansieringsrörelse,

37. lag om ändring i lagen (2005:377) om straff för marknadsmissbruk vid handel med finansiella instrument,

38. lag om ändring i lagen (2005:405) om försäkringsförmedling, 39. lag om ändring i aktiebolagslagen (2005:551), 40. lag om ändring i lagen (2005:1047) om internationella förhållanden rörande försäkringsföretags och kreditinstituts insolvens,

41. lag om ändring i lagen (2006:451) om offentliga uppköpserbjudanden på aktiemarknaden,

42. lag om ändring i lagen (2006:531) om särskild tillsyn över finansiella konglomerat,

43. lag om ändring i lagen (2006:1371) om kapitaltäckning och stora exponeringar,

44. lag om ändring i lagen (2006:1372) om införande av lagen (2006:1371) om kapitaltäckning och stora exponeringar.

12

2 Lagtext

2.1 Förslag till lag om värdepappersmarknaden

Härigenom föreskrivs

TPF

1

FPT

följande.

FÖRSTA AVDELNINGEN

Inledande bestämmelser

1 kap. Allmänna bestämmelser

Lagens tillämpningsområde

1 § I denna lag finns bestämmelser om värdepappersmarknaden.

I 2–11 kap. finns särskilda bestämmelser om värdepappersrörelse, i 12–18 kap. om börsverksamhet m.m. och i 19–21 kap. om clearingverksamhet. I 22–26 kap. finns vissa gemensamma bestämmelser.

2 § För utländska företags verksamhet i Sverige gäller bestämmelserna i denna lag i tillämpliga delar. För filialer till utländska företag gäller i övrigt lagen (1992:160) om utländska filialer m.m.

Europabolag och europakooperativ

3 § I fråga om europabolag och europakooperativ som har ett sådant förvaltningssystem som avses i artiklarna 39–42 i rådets förordning (EG) nr 2157/2001 av den 8 oktober 2001 om stadga för europabolag

TPF

2

FPT

eller

artiklarna 37–41 i rådets förordning (EG) nr 1435/2003 av den 22 juli 2003 om stadga för europeiska kooperativa föreningar (SCE-föreningar)

TPF

3

FPT

skall det som sägs i följande bestämmelser i denna lag om styrelsen eller dess ledamöter tillämpas på tillsynsorganet eller dess ledamöter:

– 1 kap. 11 § om tystnadsplikt i fråga om värdepappersbolag, – 1 kap. 13 § om meddelandeförbud, – 3 kap. 1 § första stycket 5, 12 kap. 2 § 4 och 19 kap. 3 § 4 om ledningsprövning,

– 8 kap. 38 § andra stycket 1 och femte stycket om kredit m.m. till styrelseledamot,

– 23 kap. 11 § om rätt för Finansinspektionen att sammankalla styrelsen och närvara vid sådant sammanträde och delta i överläggningarna, samt

TP

1

PT

Jfr Europaparlamentets och rådets direktiv 2004/39/EG av den 21 april 2004 om

marknader för finansiella instrument och om ändring av rådets direktiv 85/611/EEG och 93/6/EEG och Europaparlamentets och rådets direktiv 2000/12/EG samt upphävande av rådets direktiv 93/22/EEG (EUT L 145, 30.4.2004, s. 1, Celex 32004L0039), senast ändrat genom Europaparlamentets och rådets direktiv 2006/31/EG (EUT L 114, 27.4.2006, s. 60, Celex 32006L0031) och Kommissionens direktiv 2006/73/EG av den 10 augusti 2006 om genomförandet av Europaparlamentets och rådets direktiv 2004/39/EG vad gäller organisatoriska krav och villkor för verksamheten i värdepappersföretag, och definitioner för tillämpning av det direktivet (EUT L 241, 2.9.2006, s. 26, Celex 32006L0073).

TP

2

PT

EGT L 294, 10.11.2001, s. 1 (Celex 32001R2157).

TP

3

PT

EUT L 207, 18.8.2003, s. 1 (Celex 32003R1435).

13

– 25 kap. 4 § om återkallelse av tillstånd. Av 16 § andra stycket och 22 § lagen (2004:575) om europabolag samt 21 § andra stycket och 26 § lagen (2006:595) om europakooperativ framgår att de i första stycket angivna bestämmelserna om styrelsen eller dess ledamöter skall tillämpas också på ett europabolags eller ett europakooperativs lednings- eller förvaltningsorgan eller dess ledamöter.

Definitioner av olika finansiella instrument

4 § I denna lag betyder

1. finansiella instrument: överlåtbara värdepapper, penningmarknadsinstrument, fondandelar och finansiella derivatinstrument,

2. överlåtbara värdepapper: sådana värdepapper utom betalningsmedel som kan bli föremål för handel på kapitalmarknaden, till exempel:

a) aktier i aktiebolag och motsvarande andelsrätter i andra typer av företag samt depåbevis för aktier,

b) obligationer och andra skuldförbindelser inklusive depåbevis för sådana värdepapper, och

c) andra värdepapper som ger rätt att överlåta eller förvärva sådana överlåtbara värdepapper som anges i a och b, eller som resulterar i en kontantavveckling som beräknas utifrån kurser på överlåtbara värdepapper, valutor, räntor eller avkastningar, råvaror eller andra index eller mått,

3. penningmarknadsinstrument: statsskuldväxlar, inlåningsbevis, företagscertifikat och andra instrument som normalt omsätts på penningmarknaden, dock inte betalningsmedel,

4. fondandelar: andelar i investeringsfonder, fondföretag och andra företag för kollektiva investeringar,

5. finansiella derivatinstrument: sådana derivatinstrument som kan hänföras till någon av följande kategorier:

a) optioner, terminskontrakt, swappar, räntesäkringsavtal och varje annat derivatkontrakt som avser värdepapper, valutor, räntor eller avkastningar, eller andra derivatinstrument, finansiella index eller finansiella mått som kan avvecklas fysiskt eller kontant,

b) optioner, terminskontrakt, swappar, räntesäkringsavtal och varje annat derivatkontrakt som avser råvaror, som måste avvecklas kontant eller kan avvecklas kontant på en av parternas begäran, på grund av ett annat skäl än utebliven betalning eller någon annan händelse som leder till att kontraktet upphör,

c) optioner, terminskontrakt, swappar och varje annat derivatkontrakt som avser råvaror som kan avvecklas fysiskt förutsatt att de handlas på en reglerad marknad eller en handelsplattform,

d) optioner, terminskontrakt, swappar, terminskontrakt som inte är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför EES (forwards) och varje annat derivatkontrakt som

– avser råvaror, – kan avvecklas fysiskt, – inte omnämns i c och som inte är för kommersiella ändamål, och – som anses ha egenskaper som andra derivat avseende finansiella instrument, med utgångspunkt från bland annat om clearing och

14

avveckling sker via erkända system för clearing eller om de är föremål för regelmässiga marginalsäkerhetskrav,

e) derivatinstrument för överföring av kreditrisk,

f) finansiella kontrakt avseende prisdifferenser,

g) optioner, terminskontrakt, swappar, räntesäkringsavtal och varje annat derivatkontrakt som avser klimatvariationer, fraktavgifter, utsläppsrätter eller inflationstakten eller någon annan officiell ekonomisk statistik, som måste avvecklas kontant eller kan avvecklas kontant på en av parternas begäran, på grund av ett annat skäl än utebliven betalning eller någon annan händelse som leder till att kontraktet upphör, samt varje annat derivatkontrakt som

– avser tillgångar, rättigheter, skyldigheter, index och åtgärder som inte tidigare omnämnts i denna punkt, och

– anses ha egenskaper som andra derivat avseende finansiella instrument, med utgångspunkt från bland annat om det handlas på en reglerad marknad eller en handelsplattform, om clearing och avveckling sker via erkända system för clearing eller om de är föremål för regelmässiga marginalsäkerhetskrav.

Ytterligare bestämmelser om vilka derivatinstrument som omfattas av första stycket 5 d och g finns i artiklarna 38 och 39 i genomförandeförordningen.

Övriga definitioner

5 § I denna lag betyder

1. anknutet ombud: en fysisk eller juridisk person som har träffat avtal med ett svenskt värdepappersinstitut eller ett utländskt värdepappersföretag som hör hemma inom EES om att för bara detta instituts eller företags räkning

a) marknadsföra investerings- eller sidotjänster,

b) ta emot eller vidarebefordra instruktioner eller order avseende investeringstjänster eller finansiella instrument,

c) placera finansiella instrument, eller

d) tillhandahålla investeringsrådgivning till kund avseende dessa instrument eller tjänster,

2. behörig myndighet: i Sverige Finansinspektionen och i särskilt angivna fall Bolagsverket och i övrigt en utländsk myndighet som har behörighet att utöva tillsyn över utländska värdepappersföretag och företag som driver en reglerad marknad eller annan motsvarande marknad eller som har behörighet att utöva tillsyn över emittenter vars överlåtbara värdepapper är upptagna till handel på en reglerad marknad,

3. börs: ett svenskt aktiebolag eller en svensk ekonomisk förening som har fått tillstånd enligt denna lag att driva en eller flera reglerade marknader,

4. clearingdeltagare: den som får delta i clearingverksamheten hos en clearingorganisation,

5. clearingorganisation: ett företag som har fått tillstånd enligt 19 kap. att driva clearingverksamhet,

6. clearingverksamhet: fortlöpande verksamhet som består i att

15

a) på clearingdeltagarnas vägnar göra avräkningar i fråga om deras förpliktelser att leverera finansiella instrument eller att betala i svensk eller utländsk valuta,

b) genom att träda in som part eller som garant ta över ansvaret för att förpliktelserna fullgörs, eller

c) på annat väsentligt sätt ansvara för att förpliktelserna avvecklas genom överförande av likvid eller instrument,

7. direktivet om marknader för finansiella instrument: Europaparlamentets och rådets direktiv 2004/39/EG av den 21 april 2004 om marknader för finansiella instrument och om ändring av rådets direktiv 85/611/EEG och 93/6/EEG och Europaparlamentets och rådets direktiv 2000/12/EG samt upphävande av rådets direktiv 93/22/EEG

TPF

4

FPT

,

senast ändrat genom Europaparlamentets och rådets direktiv 2006/31/EG

TPF

5

FPT

,

8. EES: Europeiska ekonomiska samarbetsområdet,

9. emittent: i fråga om aktier aktiebolaget och i fråga om annat finansiellt instrument utgivaren eller utfärdaren av instrumentet,

10. filial: ett avdelningskontor med självständig förvaltning, varvid även ett utländskt värdepappersföretags etablering av flera driftställen i Sverige skall anses som en enda filial,

11. genomförandeförordningen: kommissionens förordning (EG) nr 1287/2006 av den 10 augusti 2006 om genomförande av Europaparlamentets och rådets direktiv 2004/39/EG vad gäller dokumenteringsskyldigheter för värdepappersföretag, transaktionsrapportering, överblickbarhet på marknaden, upptagande av finansiella instrument till handel samt definitioner för tillämpning av det direktivet

TPF

6

FPT

,

12. handelsplattform: ett multilateralt handelssystem (Multilateral Trading Facility, MTF) inom EES som drivs av ett värdepappersinstitut eller en börs och som sammanför ett flertal köp- och säljintressen i finansiella instrument från tredje man – inom systemet och i enlighet med icke skönsmässiga regler – så att detta leder till avslut,

13. hemland: det land där ett företag har fått tillstånd att driva sådan verksamhet som avses i denna lag,

14. investeringstjänster och investeringsverksamheter: de tjänster och verksamheter som anges i 2 kap. 1 §,

15. kapitalbas: detsamma som i 3 kap. lagen (2006:1371) om kapitaltäckning och stora exponeringar,

16. koncern: detsamma som i 1 kap.11 och 12 §§aktiebolagslagen (2005:551), varvid det som sägs om moderbolag tillämpas även på andra juridiska personer än aktiebolag,

17. kreditinstitut: bank, kreditmarknadsföretag och utländskt bank- eller kreditföretag som driver bank- eller finansieringsrörelse från filial i Sverige,

18. kvalificerat innehav: ett direkt eller indirekt ägande i ett företag, om innehavet representerar 10 procent eller mer av kapitalet eller av samtliga röster eller annars möjliggör ett väsentligt inflytande över ledningen av företaget,

TP

4

PT

EUT L 145, 30.4.2004, s. 1 (Celex 32004L0039).

TP

5

PT

EUT L 114, 27.4.2006, s. 60 (Celex 32006L0031).

TP

6

PT

EUT L 241, 2.9.2006, s. 1 (Celex 32006R1287).

16

19. professionell kund: en sådan kund som avses i 8 kap. 16 eller 17 §, 20. reglerad marknad: ett multilateralt system inom EES som sammanför eller möjliggör sammanförande av ett flertal köp- och säljintressen i finansiella instrument från tredje man – regelmässigt, inom systemet och i enlighet med icke skönsmässiga regler – så att detta leder till avslut,

21. sidotjänster: de tjänster som anges i 2 kap. 2 §, 22. sidoverksamheter:

a) för ett värdepappersbolag de verksamheter som anges i 2 kap. 3 och 4 §§,

b) för en börs de verksamheter som anges i 13 kap. 12 §, och

c) för en clearingorganisation de verksamheter som anges i 20 kap. 7 §, 23. startkapital: detsamma som i 1 kap. 5 § 17 lagen (2004:297) om bank- och finansieringsrörelse,

24. systematisk internhandlare: värdepappersinstitut som på ett organiserat, frekvent och systematiskt sätt handlar för egen räkning genom att utföra kundorder utanför en reglerad marknad eller en handelsplattform,

25. utländskt värdepappersföretag: ett utländskt företag som i hemlandet har tillstånd att driva värdepappersrörelse,

26. värdepappersbolag: ett svenskt aktiebolag som har fått tillstånd enligt denna lag att driva värdepappersrörelse och som inte är ett bankaktiebolag eller ett kreditmarknadsbolag enligt lagen om bank- och finansieringsrörelse,

27. värdepappersinstitut: värdepappersbolag, svenska kreditinstitut som har fått tillstånd enligt denna lag att driva värdepappersrörelse och utländska företag som driver värdepappersrörelse från filial i Sverige,

28. värdepappersrörelse: verksamhet som består i att yrkesmässigt tillhandahålla investeringstjänster eller utföra investeringsverksamhet, och

29. öppenhetsdirektivet: Europaparlamentets och rådets direktiv 2004/109/EG av den 15 december 2004 om harmonisering av insynskraven angående upplysningar om emittenter vars värdepapper är upptagna till handel på en reglerad marknad och om ändring av direktiv 2001/34/EG

TPF

7

FPT

.

6 § Ett värdepappersbolag och ett annat företag har nära förbindelser, om

1. det ena företaget direkt eller indirekt genom dotterbolag äger minst 20 procent av kapitalet eller disponerar över minst 20 procent av samtliga röster i det andra företaget,

2. det ena företaget direkt eller indirekt utgör moderföretag till det andra eller det finns en annan likartad förbindelse mellan företagen, eller

3. båda företagen är dotterföretag till eller har en likartad förbindelse med en och samma juridiska person eller står i ett motsvarande förhållande till en och samma fysiska person.

Nära förbindelser har även en fysisk person och ett värdepappersbolag, om

1. den fysiska personen

TP

7

PT

EUT L 390, 31.12.2004, s. 38 (Celex 32004L0109).

17

a) äger minst 20 procent av kapitalet i värdepappersbolaget,

b) disponerar över minst 20 procent av samtliga röster i värdepappersbolaget, eller

c) på annat sätt har sådant inflytande över värdepappersbolaget att personens ställning motsvarar den som ett moderföretag har i förhållande till ett dotterföretag, eller

2. det finns annan likartad förbindelse mellan denna person och värdepappersbolaget.

Hemmedlemsstat

7 § Sverige är hemmedlemsstat för en utgivare som har sitt säte här, om utgivaren

1. är ett aktiebolag som har gett ut aktier som är upptagna till handel på en reglerad marknad, eller

2. har gett ut sådana skuldebrev som avses i 18 kap. 2 § första stycket och som

a) vart och ett har ett nominellt värde som understiger motsvarande 1 000 euro, och

b) är upptagna till handel på en reglerad marknad.

8 § Sverige är hemmedlemsstat för en utgivare som inte har säte i en stat inom EES, om

1. utgivaren har gett ut aktier eller sådana skuldebrev som avses i 18 kap. 2 § första stycket och vart och ett av skuldebreven har ett nominellt värde som understiger motsvarande 1 000 euro,

2. dessa överlåtbara värdepapper är upptagna till handel på en reglerad marknad, och

3. utgivaren till följd av detta, eller på grund av att dessa överlåtbara värdepapper har erbjudits till allmänheten i Sverige, är skyldig att ge in ett dokument enligt 6 kap. 1 b § lagen (1991:980) om handel med finansiella instrument till Finansinspektionen.

9 § Sverige är hemmedlemsstat för en emittent i andra fall än som anges i 7 eller 8 §, om denne har gett ut eller utfärdat överlåtbara värdepapper som är upptagna till handel på en reglerad marknad och emittenten väljer att Sverige skall vara hemmedlemsstat.

En emittent får välja att Sverige skall vara hemmedlemsstat bara om emittenten har sitt säte här eller om de överlåtbara värdepapperen är upptagna till handel på en reglerad marknad i Sverige.

En emittent som har valt att Sverige skall vara hemmedlemsstat får ändra detta val tidigast efter tre år, om inte förutsättningarna i första stycket dessförinnan har upphört att gälla.

Överlåtbara värdepapper som är upptagna till handel i en annan stat inom EES

10 § Om Sverige är hemmedlemsstat för en emittent vars överlåtbara värdepapper inte är upptagna till handel på en reglerad marknad i Sverige efter ansökan av emittenten, men är upptagna till handel på en reglerad

18

marknad i en annan stat inom EES efter en sådan ansökan, skall 15 kap. 6 § första stycket 3 om kurspåverkande information, 15 kap. 8 § om förändringar i rättigheter och om nya emissioner samt följande bestämmelser i 18 kap. tillämpas av emittenten:

– 1 § om skyldighet att utse ett finansiellt institut, – 2–6 §§ om utgivare av skuldebrev, och – 7–12 §§ om utgivare som inte har säte i en stat inom EES. Av 16 kap. 1 § framgår att bestämmelserna i 16 kap. är tillämpliga på sådana emittenter som anges i första stycket.

Tystnadsplikt

11 § Den som är eller har varit knuten till ett värdepappersbolag, en börs eller en clearingorganisation som anställd eller uppdragstagare får inte obehörigen röja eller utnyttja vad han eller hon i anställningen eller under uppdraget har fått veta om någon annans affärsförhållanden eller personliga förhållanden.

I det allmännas verksamhet tillämpas i stället bestämmelserna i sekretesslagen (1980:100).

I 5 a § kreditupplysningslagen (1973:1173) finns bestämmelser som innebär att det som gäller om tystnadsplikt enligt första stycket inte hindrar att uppgifter i vissa fall utväxlas för kreditupplysningsändamål.

Uppgiftsskyldighet

12 § Ett värdepappersbolag, en börs och en clearingorganisation är skyldiga att lämna ut uppgifter om enskildas förhållanden till företaget, om det under en utredning enligt bestämmelserna om förundersökning i brottmål begärs av undersökningsledare eller om det i ett ärende om rättslig hjälp i brottmål på framställning av en annan stat eller en mellanfolklig domstol begärs av åklagare.

Meddelandeförbud

13 § Den undersökningsledare eller åklagare som begär uppgifter enligt 12 § får besluta att värdepappersbolaget, börsen eller clearingorganisationen samt dess styrelseledamöter och anställda inte får röja för kunden eller för någon utomstående att uppgifter har lämnats enligt 12 § eller att det pågår en förundersökning eller ett ärende om rättslig hjälp i brottmål.

Ett sådant förbud får meddelas om det krävs för att en utredning om brott inte skall äventyras eller för att uppfylla en internationell överenskommelse som är bindande för Sverige.

Förbudet skall vara tidsbegränsat, med möjlighet till förlängning, och får inte avse längre tid än vad som är motiverat med hänsyn till syftet med förbudet. I ett ärende om rättslig hjälp i brottmål får dock förbudet tidsbegränsas bara om den stat eller mellanfolkliga domstol som ansökt om rättslig hjälp samtycker till detta.

Om ett förbud inte längre är motiverat med hänsyn till syftet med förbudet, skall undersökningsledaren eller åklagaren besluta att förbudet skall upphöra.

19

Ansvarsbestämmelse

14 § Till böter döms den som uppsåtligen eller av grov oaktsamhet bryter mot ett meddelandeförbud enligt 13 §.

Bemyndigande

15 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om hur en emittent skall offentliggöra valet av hemmedlemsstat enligt 9 §.

20

ANDRA AVDELNINGEN

Värdepappersrörelse

2 kap. Tillståndspliktig värdepappersrörelse m.m.

Tillståndsplikt

Investeringstjänster och investeringsverksamheter

1 § För att driva värdepappersrörelse krävs tillstånd av Finansinspektionen, om inte något annat framgår av denna lag. Tillstånd får ges för

1. mottagande och vidarebefordran av order i fråga om ett eller flera finansiella instrument,

2. utförande av order avseende finansiella instrument på kunders uppdrag,

3. handel med finansiella instrument för egen räkning,

4. diskretionär portföljförvaltning avseende finansiella instrument,

5. investeringsrådgivning till kund avseende finansiella instrument,

6. garantigivning avseende finansiella instrument och placering av finansiella instrument med ett fast åtagande,

7. placering av finansiella instrument utan fast åtagande, och

8. drift av handelsplattformar.

Sidotjänster

2 § Ett värdepappersbolag får efter tillstånd av Finansinspektionen som ett led i rörelsen

1. förvara finansiella instrument för kunders räkning och ta emot medel med redovisningsskyldighet,

2. lämna kunder kredit för att kunden, genom värdepappersbolaget, skall kunna genomföra en transaktion i ett eller flera finansiella instrument,

3. lämna råd till företag om kapitalstruktur, företagsstrategi och liknande frågor samt lämna råd och utföra tjänster vid fusioner och företagsuppköp,

4. utföra valutatjänster om dessa har samband med investeringstjänster,

5. utarbeta och sprida investerings- och finansanalyser samt andra former av allmänna rekommendationer rörande handel med finansiella instrument,

6. utföra tjänster i samband med garantigivning avseende finansiella instrument,

7. utföra investeringstjänster, investeringsverksamhet och sidotjänster avseende underliggande faktorer till sådana finansiella derivatinstrument som avses i 1 kap. 4 § första stycket 5 b–d och g, och

8. ta emot kunders medel på konto för att underlätta värdepappersrörelsen.

Tillstånd enligt första stycket 8 får ges bara tillsammans med tillstånd enligt första stycket 2.

21

Sidoverksamheter

3 § Ett värdepappersbolag får efter tillstånd av Finansinspektionen driva annan verksamhet än att tillhandahålla de sidotjänster som anges i 2 §.

Ett värdepappersbolag får efter tillstånd av Finansinspektionen driva valutahandel.

Tillstånd enligt första stycket behövs inte för att utöva försäkringsförmedling under de förutsättningar som föreskrivs i lagen (2005:405) om försäkringsförmedling.

4 § I lagen (1993:931) om individuellt pensionssparande finns bestämmelser om rätt för värdepappersinstitut att driva pensionssparrörelse.

I lagen (2004:46) om investeringsfonder finns bestämmelser om rätt för värdepappersbolag och svenska kreditinstitut som har tillstånd för portföljförvaltning enligt 2 kap. 1 § 4 denna lag att driva fondverksamhet som avser specialfonder.

Undantag från tillståndsplikt

5 § Tillstånd enligt 1 § behövs inte för

1. Sveriges riksbank, Riksgäldskontoret och Kammarkollegiet,

2. anknutna ombud för de verksamheter som anges i 1 kap. 5 § 1,

3. börs som driver verksamhet med stöd av sitt tillstånd,

4. försäkringsföretag med koncession enligt försäkringsrörelselagen (1982:713),

5. företag inom en koncern som tillhandahåller investeringstjänster uteslutande till andra företag i koncernen,

6. fysiska och juridiska personer som tillhandahåller investeringstjänster, om tjänsten tillhandahålls tillfälligt i samband med annan yrkesmässig verksamhet som regleras av

a) bestämmelser i lag eller annan författning, eller

b) etiska regler som avser yrkesverksamheten i fråga och som inte utesluter att tjänsten tillhandahålls,

7. fysiska och juridiska personer som inte tillhandahåller investeringstjänster eller utför investeringsverksamhet utom handel för egen räkning, såvida de inte

a) är marknadsgaranter, eller

b) handlar för egen räkning utanför en reglerad marknad eller en handelsplattform på ett organiserat, frekvent och systematiskt sätt genom att tillhandahålla ett system som är tillgängligt för någon utomstående i syfte att handla med denne,

8. företag som tillhandahåller investeringstjänster som uteslutande består i förvaltning av ett program som syftar till delägarskap för de anställda i företaget,

9. företag som tillhandahåller både

a) investeringstjänster som uteslutande består i förvaltning av program som syftar till delägarskap för de anställda i företaget, och

b) andra investeringstjänster än sådana som anges i a uteslutande till andra företag i koncernen,

10. fondbolag, förvaltningsbolag och fondföretag som får driva verksamhet enligt lagen (2004:46) om investeringsfonder,

22

11. företag som handlar med finansiella instrument för egen räkning eller tillhandahåller investeringstjänster i fråga om derivatinstrument med råvaror som underliggande tillgång eller sådana derivatkontrakt som avses i 1 kap. 4 § första stycket 5 c till kunderna i sin huvudsakliga verksamhet, om

a) detta utgör en kompletterande verksamhet eller, om företaget ingår i en koncern, detta utgör en kompletterande verksamhet sett till koncernen i dess helhet, och

b) den huvudsakliga verksamheten inte utgörs av tillhandahållande av investeringstjänster eller sådana tjänster som avses i 7 kap. 1 § lagen (2004:297) om bank- och finansieringsrörelse,

12. fysiska och juridiska personer som tillhandahåller investeringsrådgivning till kund inom ramen för annan yrkesmässig verksamhet än sådan som omfattas av bestämmelserna i denna lag, om det inte lämnas någon specifik ersättning för rådgivningen,

13. företag vars huvudsakliga verksamhet utgörs av handel för egen räkning med råvaror eller derivatinstrument med råvaror som underliggande tillgång, om företaget inte ingår i en koncern vars huvudsakliga verksamhet utgörs av tillhandahållande av investeringstjänster eller sådana tjänster som avses i 7 kap. 1 § lagen om bank- och finansieringsrörelse,

14. företag som tillhandahåller investeringstjänster eller utför investeringsverksamhet

a) som uteslutande består i handel för egen räkning på marknader för finansiella terminer, optioner eller andra derivatinstrument och på avistamarknader bara i syfte att skydda derivatpositioner, eller

b) som dels handlar på uppdrag av andra medlemmar på marknaderna som anges i a eller ställer priser för dem, dels garanteras av clearingdeltagare på dessa marknader, om ansvaret för att avtal som ingås av företagen fullgörs bärs av clearingdeltagarna, och

15. verksamhet enligt 1 § 1 och 5 som drivs av den som är registrerad för förmedling av alla slag av försäkringar eller bara livförsäkringar enligt 2 kap. 3 § lagen (2005:405) om försäkringsförmedling, om

a) verksamheten bara är en sidoverksamhet till försäkringsförmedlingen och bara avser mottagande och vidarebefordran av order avseende andelar i investeringsfonder eller sådana fondföretag som avses i 1 kap. 7 och 9 §§ lagen om investeringsfonder samt investeringsrådgivning till kund avseende sådana andelar,

b) kunders order vidarebefordras bara direkt till fondbolag, förvaltningsbolag samt fondföretag som avses i a, och

c) försäkringsförmedlaren i denna verksamhet inte tar emot kunders medel eller fondandelar.

Tillstånd krävs inte heller för sådan förvaltning av finansiella instrument som är reglerad i någon annan lag.

6 § I 4 kap. finns ytterligare undantag från tillståndsplikt för vissa företag som hör hemma inom EES.

23

3 kap. Tillstånd för svenska företag

Värdepappersbolag

Förutsättningar för tillstånd

1 § Tillstånd att driva värdepappersrörelse skall ges ett svenskt aktiebolag, om

1. bolaget har sitt huvudkontor i Sverige,

2. bolagsordningen inte strider mot denna lag eller någon annan författning,

3. det finns skäl att anta att den planerade verksamheten kommer att drivas enligt bestämmelserna i denna lag och andra författningar som reglerar bolagets verksamhet,

4. det finns skäl att anta att den som har eller kan förväntas komma att få ett kvalificerat innehav i bolaget

a) inte kommer att motverka att verksamheten drivs på ett sätt som är förenligt med denna lag och andra författningar som reglerar bolagets verksamhet, och

b) även i övrigt är lämplig att utöva ett väsentligt inflytande över ledningen av ett värdepappersbolag,

5. den som skall ingå i bolagets styrelse eller vara verkställande direktör, eller vara ersättare för någon av dem, har tillräcklig insikt och erfarenhet för att delta i ledningen av ett värdepappersbolag och även i övrigt är lämplig för en sådan uppgift, och

6. bolaget uppfyller de villkor i övrigt som anges i denna lag. Tillstånd att driva sidoverksamhet enligt 2 kap. 3 § första stycket skall ges ett värdepappersbolag, om det finns särskilda skäl och verksamheten kan komma att underlätta rörelsen.

2 § Tillstånd enligt 1 § första stycket får inte ges, om

1. någon som i väsentlig utsträckning har åsidosatt sina skyldigheter i näringsverksamhet eller andra ekonomiska angelägenheter eller som har gjort sig skyldig till allvarlig brottslighet, har eller kan förväntas komma att få ett kvalificerat innehav i bolaget, eller

2. ledningen i ett finansiellt holdingföretag eller ett blandat finansiellt holdingföretag som kommer att ha ett kvalificerat innehav i bolaget inte uppfyller de krav som ställs på ledningen i ett sådant företag enligt 9 kap. 13 § lagen (2006:1371) om kapitaltäckning och stora exponeringar respektive 5 kap. 16 § lagen (2006:531) om särskild tillsyn över finansiella konglomerat.

Om bolaget har eller kan förväntas komma att få nära förbindelser med någon annan, får tillstånd ges bara om förbindelserna inte hindrar en effektiv tillsyn av värdepappersbolaget.

Godkännande av bolagsordning

3 § Bolagsordningen för ett värdepappersbolag skall godkännas av Finansinspektionen i samband med att det får tillstånd att driva värdepappersrörelse.

24

4 § Ett värdepappersbolag som har beslutat att ändra sin bolagsordning skall hos Finansinspektionen ansöka om godkännande av ändringen. Ändringen skall godkännas om bolagsordningen stämmer överens med denna lag och andra författningar samt i övrigt innehåller de särskilda bestämmelser som behövs med hänsyn till omfattningen och arten av bolagets verksamhet.

Ett beslut om ändring av bolagsordning får inte registreras innan ändringen har godkänts.

Styrelse och revisor

5 § Ett värdepappersbolag skall ha en styrelse med minst tre ledamöter. Bolaget skall ha en verkställande direktör.

I ett värdepappersbolag skall minst en revisor som bolagsstämman utsett vara auktoriserad revisor eller godkänd revisor som har avlagt revisorsexamen. Till revisor kan även ett registrerat revisionsbolag utses. Bestämmelser om vem som kan vara huvudansvarig för revisionen och om underrättelseskyldighet finns i 17 § revisorslagen (2001:883).

Startkapital och kapitaltäckning

6 § Ett värdepappersbolag skall när verksamheten påbörjas ha ett startkapital som vid tidpunkten för beslut om tillstånd motsvarar

1. minst 5 000 000 euro om bolagets verksamhet skall innefatta mottagande av medel på konto enligt 2 kap. 2 § första stycket 8,

2. minst 730 000 euro om bolaget skall driva verksamhet som avses i 2 kap. 1 § 3, 6 och 8,

3. minst 125 000 euro om inte högre belopp krävs enligt 1 eller 2, och

4. minst 50 000 euro om bolaget skall driva enbart verksamhet som avses i 2 kap. 1 § 1 eller 5 och inte kommer att inneha kunders medel eller värdepapper.

Ett värdepappersbolag som avses i första stycket 4 får som ett alternativ till startkapital ha

1. en ansvarsförsäkring med ett försäkringsbelopp om motsvarande minst 1 000 000 euro per skadeståndskrav och minst 1 500 000 euro per år för samtliga skadeståndskrav,

2. en garanti eller liknande utfästelse som ger ett motsvarande skydd, eller

3. en kombination av startkapital och försäkring eller garanti eller liknande utfästelse som ger ett motsvarande skydd.

Om värdepappersbolaget är registrerat som försäkringsförmedlare enligt 2 kap. 3 § lagen (2005:405) om försäkringsförmedling, gäller dock i stället för första stycket 4 att bolaget skall ha ett startkapital som motsvarar minst 25 000 euro eller ha en ansvarsförsäkring eller en garanti eller liknande utfästelse som täcker den skadeståndsskyldighet som kan uppkomma till följd av verksamheten. Antingen skall försäkringsbeloppet uppgå till motsvarande minst 500 000 euro per skadeståndskrav och minst 750 000 euro per år för samtliga skadeståndskrav eller skall bolaget ha en kombination av startkapital och försäkring eller garanti eller liknande utfästelse som ger ett motsvarande skydd.

25

7 § Bestämmelser om kapitaltäckning och stora exponeringar finns i lagen (2006:1371) om kapitaltäckning och stora exponeringar.

Ett värdepappersbolags kapitalbas får inte understiga det belopp som enligt 6 § krävdes när verksamheten påbörjades. För ett värdepappersbolag som har bytt redovisningsvaluta gäller i stället att kapitalbasen inte får understiga det högsta av de belopp som avses i 6 och 7 §§ lagen (2000:35) om byte av redovisningsvaluta i finansiella företag.

Ett värdepappersbolags alternativ till startkapital enligt 6 § andra eller tredje stycket får inte i värde understiga vad som krävdes när verksamheten påbörjades.

Ansökan om tillstånd

8 § Ett aktiebolag får ansöka om tillstånd innan bolaget har registrerats i aktiebolags- eller europabolagsregistret.

Om ett aktiebolag har ansökt om tillstånd inom sex månader från stiftelseurkundens undertecknande, räknas den tid som anges i 2 kap. 22 § aktiebolagslagen (2005:551) från tillståndsbeslutet.

Samråd med andra behöriga myndigheter

9 § Finansinspektionen skall innan den beslutar om tillstånd samråda med behörig myndighet i ett annat land inom EES, om bolaget

1. är eller kan förväntas bli dotterföretag till ett värdepappersföretag, ett kreditinstitut eller ett försäkringsföretag med auktorisation i det landet,

2. är eller kan förväntas bli dotterföretag till moderföretaget till ett värdepappersföretag, ett kreditinstitut, ett företag för elektroniska pengar eller ett försäkringsföretag med auktorisation i det landet, eller

3. kontrolleras eller kan förväntas komma att kontrolleras av samma fysiska eller juridiska personer som har ägarkontroll över ett värdepappersföretag, ett kreditinstitut, ett företag för elektroniska pengar eller ett försäkringsföretag med auktorisation i det landet.

Kreditinstitut

10 § Tillstånd för ett svenskt kreditinstitut att driva värdepappersrörelse skall ges om den planerade verksamheten kan antas komma att drivas enligt bestämmelserna i denna lag och andra författningar som reglerar institutets verksamhet.

Verksamhetsplan

11 § En ansökan om tillstånd enligt detta kapitel skall innehålla en verksamhetsplan för den avsedda verksamheten.

26

Bemyndiganden

12 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om vilka poster som får räknas in i startkapitalet enligt 6 §.

4 kap. Utländska företags verksamhet i Sverige

Företag hemmahörande inom EES

1 § Ett utländskt företag som hör hemma inom EES och som i hemlandet har tillstånd att driva värdepappersrörelse behöver inte tillstånd enligt 2 kap. 1 §. Ett sådant företag får

1. driva värdepappersrörelse från filial i Sverige med början två månader efter det att Finansinspektionen från en behörig myndighet i företagets hemland har tagit emot en underrättelse som innehåller

a) en verksamhetsplan för den avsedda verksamheten i Sverige med uppgift om filialens organisation,

b) uppgift om huruvida filialen avser att använda anknutna ombud, och

c) uppgift om filialens adress och ansvariga ledning, och

2. driva värdepappersrörelse genom att från sitt hemland erbjuda och tillhandahålla tjänster med början så snart Finansinspektionen från en behörig myndighet i företagets hemland har tagit emot en underrättelse som innehåller en verksamhetsplan för den avsedda verksamheten med uppgift om vilka tjänster som skall erbjudas och om huruvida företaget avser att använda anknutna ombud.

Finansinspektionen får besluta att verksamhet får påbörjas tidigare än vad som anges i första stycket 1.

2 § Tillstånd enligt 2 kap. 1 § behövs inte heller för

1. ett utländskt värdepappersföretag hemmahörande inom EES som driver en handelsplattform och som i Sverige vidtar åtgärder för att underlätta för deltagare här att använda dess system,

2. utländska kreditinstitut som driver verksamhet med stöd av 4 kap. 1 eller 2 § lagen (2004:297) om bank- och finansieringsrörelse, och

3. utländska finansiella institut som driver verksamhet med stöd av 4 kap. 3 § lagen om bank- och finansieringsrörelse.

3 § Ett företag som driver värdepappersrörelse med stöd av 1 eller 2 § får i Sverige driva bara sådan verksamhet som omfattas av verksamhetstillståndet i hemlandet.

Om ett företag som avses i första stycket driver värdepappersrörelse från filial i Sverige och använder ett anknutet ombud, skall ombudet anses ingå i företagets filial.

Företag hemmahörande utanför EES

4 § Ett företag som hör hemma utanför EES får efter tillstånd av Finansinspektionen driva värdepappersrörelse från filial i Sverige. Tillstånd till filialetablering skall ges om

27

1. företaget står under betryggande tillsyn av en behörig myndighet i hemlandet och den myndigheten har tillåtit att företaget etablerar sig i Sverige,

2. filialen tillhör ett investerarskydd som uppfyller minst de krav som gäller inom EES, och

3. det finns skäl att anta att den planerade verksamheten kommer att drivas enligt bestämmelserna i denna lag och föreskrifter som meddelats med stöd av lagen.

5 § En ansökan om tillstånd enligt 4 § skall innehålla en verksamhetsplan för den avsedda verksamheten.

6 § Ett företag med tillstånd enligt 4 § får efter tillstånd av Finansinspektionen tillhandahålla sidotjänster enligt 2 kap. 2 § eller driva sidoverksamhet enligt 2 kap. 3 §. Tillstånd får bara ges om företaget får tillhandahålla motsvarande tjänster eller driva motsvarande verksamhet i sitt hemland.

Tillstånd enligt 2 kap. 2 § första stycket 2 och 8 får bara ges om insättningar hos filialen omfattas av garanti enligt lagen (1995:1571) om insättningsgaranti eller av en utländsk garanti som

1. omfattar insättningar som anges i 2 § lagen om insättningsgaranti, och

2. har en högsta ersättningsnivå som inte understiger ett belopp motsvarande 20 000 euro innan det i förekommande fall har gjorts avdrag för en självrisk med högst 10 procent av en enskild insättares garanterade insättning.

5 kap. Svenska företags verksamhet utomlands

Filialverksamhet inom EES

1 § Ett värdepappersbolag som avser att inrätta en filial i ett annat land inom EES skall underrätta Finansinspektionen innan verksamheten påbörjas. Underrättelsen skall innehålla

1. en verksamhetsplan för den avsedda verksamheten med uppgift om filialens organisation,

2. uppgift om huruvida filialen avser att använda anknutna ombud, och

3. uppgift om i vilket land filialen skall inrättas samt om filialens adress och ansvariga ledning.

2 § Finner Finansinspektionen i fall som avses i 1 § att det inte finns skäl att ifrågasätta värdepappersbolagets administrativa struktur eller finansiella situation, skall inspektionen inom tre månader från det att underrättelsen togs emot lämna över den till den behöriga myndigheten i det land där filialen skall inrättas. Tillsammans med underrättelsen skall inspektionen lämna uppgift om investerarskydd och insättningsgaranti som gäller för kunder hos värdepappersbolaget.

Finansinspektionen skall underrätta värdepappersbolaget när inspektionen lämnar över underrättelsen enligt första stycket.

28

Om Finansinspektionen finner att det inte finns förutsättningar för att lämna över den underrättelse som avses i första stycket, skall inspektionen meddela beslut om det inom tre månader från det att underrättelsen togs emot.

3 § Om ett värdepappersbolag avser att ändra något som angetts i bolagets underrättelse till Finansinspektionen efter det att filialen inrättats, skall bolaget skriftligen underrätta inspektionen minst en månad innan ändringen genomförs. Finansinspektionen skall underrätta den behöriga myndigheten i det andra landet om ändringen.

Om Finansinspektionen finner att ändringen inte får göras, skall inspektionen meddela beslut om det inom en månad från det att underrättelsen kom in till inspektionen. Den behöriga myndigheten i det andra landet skall omedelbart underrättas om beslutet.

Vid ändring av investerarskydd eller insättningsgaranti som avses i 2 § första stycket skall Finansinspektionen underrätta den behöriga myndigheten i det land där filialen finns om ändringen.

Gränsöverskridande verksamhet inom EES

4 § Ett värdepappersbolag som avser att driva verksamhet i ett annat land inom EES, genom att erbjuda och tillhandahålla tjänster utan att inrätta filial där, skall underrätta Finansinspektionen innan verksamheten påbörjas. Underrättelsen skall innehålla

1. en verksamhetsplan för den avsedda verksamheten med uppgift om vilka tjänster som skall erbjudas,

2. uppgift om i vilket land verksamheten skall drivas, och

3. uppgift om huruvida bolaget avser att använda anknutna ombud i det landet.

Finansinspektionen skall inom en månad från det att underrättelsen togs emot lämna över den och verksamhetsplanen till den behöriga myndigheten i det land där verksamheten skall drivas.

5 § Om ett värdepappersbolag avser att ändra något som angetts i bolagets underrättelse eller verksamhetsplan till Finansinspektionen efter det att bolaget börjat driva verksamhet i det andra landet, skall bolaget skriftligen underrätta inspektionen minst en månad innan ändringen genomförs. Finansinspektionen skall underrätta den behöriga myndigheten i det andra landet om ändringen.

6 § Avser ett värdepappersbolag att använda anknutna ombud, skall Finansinspektionen lämna uppgift om vilka ombud bolaget avser att använda, om den behöriga myndigheten i det land där verksamheten skall drivas begär det.

7 § Ett värdepappersbolag som avser att vidta åtgärder i ett annat land inom EES för att underlätta för deltagare på distans att få tillträde till bolagets handelsplattform skall innan sådana åtgärder påbörjas underrätta Finansinspektionen. Finansinspektionen skall inom en månad från det att underrättelsen togs emot lämna över den till den behöriga myndigheten i det land där åtgärderna skall vidtas. På begäran skall Finansinspektionen

29

till samma myndighet lämna uppgifter om vilka från det landet som deltar på bolagets handelsplattform.

Filialverksamhet utanför EES

8 § Ett värdepappersbolag får efter tillstånd av Finansinspektionen inrätta filial i ett land utanför EES.

Ansökan om tillstånd skall innehålla

1. en verksamhetsplan för den avsedda verksamheten med uppgift om filialens organisation, och

2. uppgift om i vilket land filialen skall inrättas samt om filialens adress och ansvariga ledning.

6 kap. Särskilda bestämmelser om anknutna ombud

Registrering m.m.

1 § Ett svenskt värdepappersinstitut eller ett utländskt värdepappersföretag som hör hemma inom EES som har träffat avtal enligt 1 kap. 5 § 1 med ett anknutet ombud som har sitt driftställe i Sverige, skall anmäla ombudet för registrering hos Bolagsverket. Institutet eller företaget skall innan det träffar ett sådant avtal kontrollera att det anknutna ombudet har tillräckliga kunskaper och kvalifikationer för den verksamhet som det skall driva samt att det även i övrigt är lämpligt att driva sådan verksamhet.

I en anmälan enligt första stycket skall det anges vilken verksamhet som ombudet skall driva.

2 § Ett svenskt värdepappersinstitut som har träffat avtal enligt 1 kap. 5 § 1 med ett anknutet ombud som har sitt driftställe i ett annat land inom EES som inte tillåter att värdepappersföretag som hör hemma i det landet utser anknutna ombud, skall anmäla ombudet för registrering och utföra kontroll enligt 1 §.

3 § Ett anknutet ombud får inte påbörja sin verksamhet som anknutet ombud förrän registrering har skett.

Information till kund

4 § Ett svenskt värdepappersinstitut eller ett utländskt värdepappersföretag som hör hemma inom EES skall se till att ett anknutet ombud som det har anmält för registrering enligt 1 eller 2 § informerar kunderna om

1. vilket värdepappersinstitut eller utländskt värdepappersföretag det företräder,

2. vilka befogenheter det har, och

3. att institutet eller företaget är ansvarigt för ren förmögenhetsskada som ombudet genom sin verksamhet uppsåtligen eller av oaktsamhet orsakar kunden.

30

Ansvar för ren förmögenhetsskada

5 § Ett svenskt värdepappersinstitut eller ett utländskt värdepappersföretag som hör hemma inom EES som har träffat avtal enligt 1 kap. 5 § 1 med ett anknutet ombud är ansvarigt för ren förmögenhetsskada som ombudet genom sin verksamhet uppsåtligen eller av oaktsamhet orsakar en kund.

Rörelseregler

6 § Ett svenskt värdepappersinstitut eller ett utländskt värdepappersföretag som hör hemma inom EES skall fortlöpande se till att anknutna ombud som det har anmält för registrering enligt 1 eller 2 § uppfyller

1. kraven på kunskaper, kvalifikationer och lämplighet enligt 1 § första stycket, och

2. det som enligt 8 kap. 1 och 22–27 §§ gäller för värdepappersinstitut.

Registreringsmyndighet

7 § Bolagsverket är registreringsmyndighet för anknutna ombud som avses i 1 och 2 §§. Hos Bolagsverket förs register över anknutna ombud, där de uppgifter som enligt lag eller andra författningar skall tas in i register skrivs in.

8 § Om den som har gjort en registreringsanmälan inte har följt det som gäller om anmälan eller om det finns något annat hinder för registrering, skall Bolagsverket förelägga denne att yttra sig i frågan eller göra rättelse inom viss tid.

Om den som har gjort anmälan inte följer ett föreläggande enligt första stycket, skall anmälan skrivas av. En upplysning om detta skall tas in i föreläggandet.

Om det även sedan anmälaren har yttrat sig finns hinder för registrering som anmälaren har haft tillfälle att yttra sig över, skall Bolagsverket vägra registrering. Om det finns skäl för det, får dock verket ge den som har gjort anmälan tillfälle att yttra sig på nytt innan beslut fattas i ärendet.

Avregistrering

9 § Bolagsverket skall avregistrera ett anknutet ombud om

1. det värdepappersinstitut eller det värdepappersföretag som har träffat avtal med ombudet begär det, eller

2. värdepappersinstitutets eller värdepappersföretagets tillstånd att driva värdepappersrörelse har återkallats.

Bemyndiganden

10 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om

31

1. vilka förhållanden som skall redovisas i ett sådant avtal som avses i 1 kap. 5 § 1, och

2. vad svenska värdepappersinstitut och utländska värdepappersföretag skall iaktta enligt 1 § vid anmälan om registrering och kontroll av anknutna ombud.

7 kap. Förvärv och innehav av egendom

Innehav av egendom i allmänhet

1 § Ett värdepappersbolag får inneha bara

1. egendom som behövs för att

a) driva värdepappersrörelse, och

b) tillhandahålla sidotjänster eller driva sidoverksamhet,

2. aktier, andelar och andra finansiella instrument med de begränsningar som anges i 2–9 §§, och

3. egendom till skyddande av fordran enligt 10–12 §§.

Förvärv och innehav av aktier, andelar och andra finansiella instrument

Förvärv som ett led i organisationen av verksamheten

2 § Ett värdepappersbolag får förvärva aktier eller andelar i företag, om förvärvet ingår som ett led i organisationen av verksamheten och annat inte följer av 13 §.

Förvärv som ett led i en normal likviditetsförvaltning

3 § Ett värdepappersbolag får förvärva finansiella instrument som ett led i en normal likviditetsförvaltning.

Förvärv för investeringsverksamheten handel med finansiella instrument för egen räkning

4 § Ett värdepappersbolag som har tillstånd att driva värdepappersrörelse enligt 2 kap. 1 § 3 får förvärva finansiella instrument för den verksamheten.

Innehav vid medverkan vid emissioner

5 § Ett värdepappersbolag som har tillstånd att driva värdepappersrörelse enligt 2 kap. 1 § 6 och som i den rörelsen har förvärvat finansiella instrument, skall avyttra dessa så snart det är lämpligt och senast inom tre år från förvärvet. Om det finns synnerliga skäl, får Finansinspektionen efter ansökan besluta att de finansiella instrumenten får innehas under längre tid.

32

Förvärv av egna aktier

6 § Ett värdepappersbolag som har tillstånd att driva värdepappersrörelse enligt 2 kap. 1 § 3 eller 7 får, trots begränsningarna i 19 kap.7 och 14 §§aktiebolagslagen (2005:551) samt 6 a kap. 23 § försäkringsrörelselagen (1982:713), förvärva egna aktier och aktier i moderbolag för att underlätta sådan rörelse. Detta gäller dock bara aktier som är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför EES.

Innehavet av sådana aktier som anges i första stycket får inte överstiga fem procent av samtliga aktier i något av bolagen.

För aktier som har förvärvats med stöd av första stycket gäller inte bestämmelserna i 19 kap.9, 16 och 3137 §§aktiebolagslagen samt 6 a kap. 25 § försäkringsrörelselagen.

Kvalificerade innehav

7 § Ett värdepappersbolag som har tillstånd att driva värdepappersrörelse enligt 2 kap. 2 § första stycket 2 och 8 får ha kvalificerade innehav av aktier eller andelar i andra företag än kreditinstitut, utländska kreditinstitut, företag för elektroniska pengar, värdepappersbolag, utländska värdepappersföretag, finansiella institut, anknutna företag och försäkringsföretag inklusive återförsäkringsföretag som sammanlagt uppgår till högst 60 procent av kapitalbasen i bolaget. Ett sådant innehav i ett enskilt företag får uppgå till högst 15 procent av kapitalbasen i bolaget.

Aktier eller andelar som har förvärvats i strid med första stycket skall snarast avyttras.

Har aktier eller andelar förvärvats inom ramen för de gränser som anges i första stycket och förändras därefter förhållandet mellan de kvalificerade innehaven och kapitalbasen så att gränserna överskrids, skall bolaget så snart det är lämpligt avyttra överskjutande aktier och andelar.

8 § Vid beräkningen enligt 7 § första stycket av ett värdepappersbolags kvalificerade innehav räknas inte

1. aktier eller andelar som ett värdepappersbolag tillfälligt innehar som ett led i att skydda en fordran enligt 10–12 §§, eller

2. aktier eller andelar som ett värdepappersbolag tillfälligt innehar enligt 5 § eller i eget namn för någon annans räkning.

9 § De i 7 § första stycket angivna gränserna får överskridas om

1. det belopp med vilket det kvalificerade innehavet överskrider gränserna täcks av bolagets kapitalbas, och

2. det görs avdrag för motsvarande del av kapitalbasen vid beräkningen av kapitaltäckningsgraden enligt lagen (2006:1371) om kapitaltäckning och stora exponeringar.

Om båda de gränser som anges i 7 § första stycket överskrids, skall det största belopp som någon gräns överskrids med täckas på det sätt som beskrivs i första stycket.

33

Innehav av egendom för att skydda en fordran

10 § För att skydda en egen fordran får ett värdepappersbolag

1. på offentlig auktion, på en reglerad marknad eller en motsvarande marknad utanför EES, på en handelsplattform eller vid exekutiv försäljning köpa egendom som är utmätt eller utgör säkerhet för fordran, och

2. om det finns skäl att anta att bolaget annars skulle lida avsevärd förlust, som betalning för en fordran överta egendom som utgör säkerhet för fordran eller annan egendom.

11 § Den egendom som ett värdepappersbolag har förvärvat enligt 10 § skall avyttras så snart det är lämpligt och senast när det kan ske utan förlust för värdepappersbolaget. Har egendomen inte avyttrats inom tre år från förvärvet, krävs tillstånd av Finansinspektionen för fortsatt innehav.

12 § Det som anges i 11 § gäller inte egen aktie eller aktie i moderbolag. För förvärv av sådana aktier gäller bestämmelserna i 19 kap. aktiebolagslagen (2005:551).

Tillstånd till förvärv av egendom i vissa fall

13 § Ett värdepappersbolag får bara efter tillstånd av Finansinspektionen förvärva egendom i andra fall än som anges i 3–6 §§ om bolagets motprestation motsvarar mer än 25 procent av dess kapitalbas. Tillstånd skall inhämtas före förvärvet.

Tillstånd skall ges om det inte kan antas att förvärvet leder till överträdelse av denna lag eller andra författningar.

Svenska värdepappersinstitut som inte är värdepappersbolag

14 § Det som anges i 3–6 §§ om värdepappersbolag skall tillämpas också i fråga om svenska värdepappersinstitut som inte är värdepappersbolag.

8 kap. Skydd för investerare och andra rörelseregler

Inledande bestämmelser

1 § Ett värdepappersinstitut skall tillvarata sina kunders intressen när det tillhandahåller investeringstjänster eller sidotjänster till dessa samt handla hederligt, rättvist och professionellt. Ett värdepappersinstitut skall även i övrigt handla på ett sätt så att allmänhetens förtroende för värdepappersmarknaden upprätthålls.

2 § Av bestämmelserna om värdepappersinstitut i detta kapitel skall bara det som anges i 1, 12 och 22–33 §§ tillämpas på utländska företag som driver värdepappersrörelse i Sverige enligt 4 kap. 1 § första stycket 1.

34

Krav på organisation av verksamheten m.m.

Soliditet och likviditet

3 § Ett värdepappersbolags rörelse skall drivas på ett sådant sätt att bolagets förmåga att fullgöra sina förpliktelser inte äventyras.

Riskhantering

4 § Ett värdepappersbolag skall identifiera, mäta, styra, internt rapportera och ha kontroll över de risker som dess rörelse är förknippad med. Bolaget skall se till att det har en tillfredsställande intern kontroll.

Ett värdepappersbolag skall särskilt se till att dess kreditrisker, marknadsrisker, operativa risker och andra risker sammantagna inte medför att dess förmåga att fullgöra sina förpliktelser äventyras. För att uppfylla detta krav skall bolaget ha metoder som gör det möjligt att fortlöpande värdera och upprätthålla ett kapital som till belopp, slag och fördelning är tillräckligt för att täcka arten och nivån på de risker som bolaget är eller kan komma att bli exponerat för. Bolaget skall utvärdera dessa metoder för att säkerställa att de är heltäckande.

Genomlysning

5 § Ett värdepappersbolags rörelse skall organiseras och drivas på ett sådant sätt att bolagets struktur, förbindelser med andra företag och ställning kan överblickas.

Proportionalitet

6 § Bestämmelserna i 3–5 §§ skall tillämpas i proportion till arten och omfattningen av värdepappersbolagets verksamheter och dessas komplexitetsgrad.

Styrelsens ansvar

7 § Styrelsen i ett värdepappersbolag ansvarar för att kraven i 3–5 §§ uppfylls.

8 § Styrelsen i ett värdepappersbolag skall se till att det finns skriftliga interna riktlinjer och instruktioner i den omfattning som behövs för att uppfylla kraven i 3–6 §§ och för att i övrigt styra rörelsen. Dessa riktlinjer och instruktioner skall utvärderas och ses över regelbundet.

Interna riktlinjer, rutiner och system m.m.

9 § Ett värdepappersinstitut skall upprätta och tillämpa de riktlinjer och rutiner som krävs för att institutets styrelse, de anställda i institutet och institutets anknutna ombud skall följa de regler som gäller för verksamheten. Institutet skall även upprätta och tillämpa regler för dessa personers egna affärer med finansiella instrument.

35

10 § Ett värdepappersinstitut skall ha tillräckliga system, resurser och rutiner för att institutet skall kunna tillhandahålla investeringstjänster och utföra investeringsverksamhet kontinuerligt och regelbundet.

11 § Ett värdepappersinstitut skall

1. tillämpa sunda rutiner för

a) förvaltning av verksamheten, och

b) redovisning,

2. ha rutiner för intern kontroll,

3. ha effektiva metoder för riskbedömning, och

4. ha effektiv drift och förvaltning av sina informationssystem.

Dokumentation av utförda tjänster

12 § Ett värdepappersinstitut skall dokumentera samtliga investeringstjänster, sidotjänster och transaktioner som det har genomfört. Dokumentationen skall ske på ett sådant sätt att Finansinspektionen har möjlighet att övervaka att institutet har iakttagit kraven i denna lag och genomförandeförordningen samt i föreskrifter som har meddelats med stöd av lagen.

Marknadsövervakning

13 § Ett värdepappersinstitut som har tillstånd att driva en handelsplattform eller som på annat sätt organiserar handel i finansiella instrument enligt 2 kap. 1 § 1 skall övervaka handeln och kursbildningen och se till att handeln sker i överensstämmelse med institutets regler, denna lag, andra författningar och god sed på värdepappersmarknaden.

Uppdragsavtal

14 § Ett värdepappersinstitut får uppdra åt någon annan att utföra ett visst arbete och vissa funktioner som är av väsentlig betydelse för verksamheten, om institutet svarar för att

1. verksamheten drivs av uppdragstagaren under kontrollerade och säkerhetsmässigt betryggande former, och

2. uppdraget inte väsentligt försämrar kvaliteten på institutets internkontroll och Finansinspektionens möjligheter att övervaka att institutet följer de regler som gäller för verksamheten.

Om ett uppdragsavtal enligt första stycket innebär en väsentlig förändring av förutsättningarna för värdepappersinstitutets tillstånd att driva värdepappersrörelse, skall institutet anmäla detta till Finansinspektionen och samtidigt lämna en redogörelse för uppdragets omfattning.

36

Indelning av kunder i kategorier

Professionell kund och icke-professionell kund

15 § Ett värdepappersinstitut skall dela in sina kunder i kategorierna professionell kund och icke-professionell kund. Ett värdepappersinstitut får behandla vissa professionella kunder som jämbördiga motparter. Ett värdepappersinstitut skall upprätta interna regler och rutiner för indelning av sina kunder.

I 16 och 17 §§ finns bestämmelser om kunder som får behandlas som professionella kunder.

I 19 och 20 §§ finns bestämmelser om kunder som får behandlas som jämbördiga motparter.

16 § Ett värdepappersinstitut skall betrakta en kund som en professionell kund, om kunden ingår i någon av följande grupper:

1. enheter med tillstånd att verka på finansmarknaderna,

2. stora företag som på bolagsnivå uppfyller minst två av följande tre krav

a) balansomslutning enligt balansräkningen som motsvarar minst 20 000 000 euro,

b) nettoomsättning enligt resultaträkningen som motsvarar minst 40 000 000 euro, och

c) eget kapital enligt balansräkningen som motsvarar minst 2 000 000 euro,

3. stater, delstater, statliga och delstatliga myndigheter, offentliga organ för förvaltning av statsskulden, centralbanker och Europeiska centralbanken samt Europeiska investeringsbanken, Världsbanken, Internationella valutafonden och andra liknande mellanstatliga eller överstatliga organisationer, och

4. andra institutionella investerare än dem som omfattas av 1–3 vars huvudverksamhet är att investera i finansiella instrument, inklusive företag som ägnar sig åt värdepapperisering av tillgångar eller andra finansiella transaktioner.

Ett värdepappersinstitut skall innan det tillhandahåller en tjänst till en kund som avses i första stycket informera kunden om att den kommer att betraktas som en professionell kund och behandlas som en sådan, om inte institutet och kunden avtalar något annat. Värdepappersinstitutet skall upplysa kunden om möjligheten att begära en ändring av avtalsvillkoren för att bli behandlad som en icke-professionell kund.

Om en kund som avses i första stycket begär att bli behandlad som en icke-professionell kund, får värdepappersinstitutet ingå ett skriftligt avtal med kunden som innebär att kunden i vissa avseenden inte skall betraktas som en professionell kund.

17 § Ett värdepappersinstitut får behandla en kund som inte ingår i någon av grupperna i 16 § första stycket som en professionell kund, om kunden skriftligen har begärt hos värdepappersinstitutet att bli behandlad som en professionell kund, antingen generellt eller i fråga om en särskild investeringstjänst eller transaktion eller en viss typ av transaktion eller produkt, och kunden uppfyller minst två av följande tre krav:

37

1. Kunden har på den aktuella marknaden genomfört i genomsnitt minst tio transaktioner av betydande storlek per kvartal under de närmast föregående fyra kvartalen.

2. Värdet av kundens portfölj av finansiella instrument, definierad som insättningar av kontanta medel och innehav av finansiella instrument, överstiger motsvarande 500 000 euro.

3. Kunden arbetar, eller har arbetat minst ett år, inom finanssektorn i en befattning som kräver kunskap om de aktuella transaktionerna eller tjänsterna. För att få behandla en kund som avses i första stycket som en professionell kund måste värdepappersinstitutet

1. ha gjort en adekvat bedömning av kundens sakkunskap, erfarenhet och kunskap som ger en tillräcklig grund för att anta att kunden med tanke på de planerade transaktionernas och tjänsternas karaktär är i stånd att fatta sina egna investeringsbeslut och förstå de aktuella riskerna, och

2. ha gett kunden tydlig skriftlig information om vilken rätt till skydd och ersättning till investerare som kunden kan förlora och i ett särskilt dokument skriftligen ha fått en förklaring från kunden att den är medveten om följderna av att förlora detta skydd.

Innan ett värdepappersinstitut godtar en begäran från en kund att bli behandlad som en professionell kund, skall institutet vidta alla rimliga åtgärder för att försäkra sig om att kunden uppfyller de krav som ställs enligt första stycket.

18 § En kund som avses i 17 § skall informera värdepappersinstitutet om alla förändringar som kan påverka förutsättningarna för att kunden skall få bli behandlad som en professionell kund. Värdepappersinstitutet skall vidta lämpliga åtgärder om det får kunskap om att kunden inte längre uppfyller de ursprungliga villkor som berättigade denne att bli behandlad som en professionell kund.

Jämbördiga motparter

19 § Ett värdepappersinstitut får behandla en enhet som ingår i någon av följande grupper som en jämbördig motpart:

1. värdepappersbolag och utländska värdepappersföretag,

2. kreditinstitut,

3. försäkringsföretag,

4. värdepappersfonder som avses i 1 kap. 1 § 21 lagen (2004:46) om investeringsfonder och fondföretag som avses i 1 kap. 7 § första stycket 1 samma lag samt fondbolag eller förvaltningsbolag som förvaltar dem,

5. pensionsfonder och förvaltningsbolag som förvaltar dem,

6. andra finansiella företag än sådana som avses i 1–5 som har tillstånd att driva verksamhet enligt lagstiftningen i det land där de hör hemma eller som regleras i lagstiftning i det landet,

7. företag som är undantagna från tillståndsplikt enligt 2 kap. 5 § första stycket 13 och 14,

8. nationella regeringar och därmed sammanhängande organ, inklusive offentliga organ som har hand om statsskuld, centralbanker och överstatliga organisationer, samt

38

9. andra företag än sådana som avses i 1–8, om de skall betraktas som professionella kunder enligt 16 § första stycket 1–3.

Ett värdepappersinstitut får behandla ett företag som inte ingår i någon av grupperna i första stycket som en jämbördig motpart, om företaget

1. begär att bli behandlat som en jämbördig motpart, och

2. får behandlas som en professionell kund enligt 17 § första stycket. Ett värdepappersinstitut får behandla ett företag som en jämbördig motpart enligt andra stycket bara om företaget får behandlas som en professionell kund enligt 17 § för sådana tjänster och transaktioner.

20 § Ett värdepappersinstitut som har tillstånd att driva värdepappersrörelse enligt 2 kap. 1 § 1, 2 eller 3 får i sådan verksamhet medverka till eller inleda transaktioner med jämbördiga motparter utan att tillämpa 22– 33 §§ för dessa transaktioner och sidotjänster som är direkt knutna till transaktionerna.

En motpart har dock rätt att begära att 22–33 §§ skall tillämpas generellt i avtalsförhållandet eller avse en enskild transaktion. Om ett värdepappersinstitut samtycker till en sådan begäran från en enhet som ingår i en sådan grupp anges i 19 § första stycket 1–8, skall institutet behandla motparten som en professionell kund, om motparten inte uttryckligen begär att bli behandlad som en icke-professionell kund. Om motparten begär att bli behandlad som en icke-professionell kund, tillämpas i fråga om en sådan begäran 16 § andra och tredje styckena på motsvarande sätt.

Innan ett värdepappersinstitut inleder en transaktion med en motpart som är ett sådant företag som avses i 19 § första stycket 9, skall företaget uttryckligen ha godtagit att bli behandlat som en jämbördig motpart. Godtagandet kan ges generellt eller avse en enskild transaktion.

I fråga om motparter som inte ingår i någon av de grupper som anges i 19 § första stycket 1–8 och som hör hemma i ett annat land inom EES gäller första stycket bara om motparten i den staten erkänns som jämbördig motpart i enlighet med artikel 24.3 i direktivet om marknader för finansiella instrument. I sådana fall tillämpas tredje stycket på motsvarande sätt.

Uppföranderegler m.m.

Intressekonflikter

21 § Ett värdepappersinstitut skall vidta alla rimliga åtgärder för att

1. identifiera de intressekonflikter som kan uppkomma mellan institutet, ett anknutet ombud eller någon närstående person till dem och en kund eller mellan kunder i samband med tillhandahållande av investeringstjänster och sidotjänster, samt

2. förhindra att kundernas intressen påverkas negativt av intressekonflikter.

Om de åtgärder som ett institut har vidtagit enligt första stycket 1 inte räcker för att förhindra att kundernas intressen kan komma att påverkas negativt, skall institutet tydligt informera kunden om arten av eller källan till intressekonflikterna innan institutet åtar sig att utföra en investeringstjänst eller sidotjänst för kundens räkning.

39

Information till kund

22 § Ett värdepappersinstitut skall förse sina kunder med lättbegriplig information om

1. värdepappersinstitutet och dess tjänster,

2. finansiella instrument och föreslagna placeringsstrategier,

3. handelsplatser,

4. priser och avgifter, samt

5. institutets riktlinjer för utförande av order. Informationen skall ge kunderna rimliga möjligheter att förstå arten av och vilka risker som är förknippade med de investeringstjänster och de finansiella instrument som institutet erbjuder. Informationen får lämnas i standardiserad form.

All information som ett värdepappersinstitut lämnar till sina kunder skall vara rättvisande och tydlig och får inte vara vilseledande. Marknadsföringsmaterial skall lätt kunna identifieras som sådant.

Särskilda bestämmelser om en näringsidkares marknadsföring av produkter och tjänster och vilken information som skall lämnas till kunder finns i marknadsföringslagen (1995:450) samt i distans- och hemförsäljningslagen (2005:59).

Inhämtande av uppgifter vid investeringsrådgivning och portföljförvaltning

23 § Ett värdepappersinstitut skall, när det tillhandahåller investeringstjänsterna investeringsrådgivning till kund avseende finansiella instrument eller diskretionär portföljförvaltning avseende finansiella instrument, hämta in nödvändiga uppgifter från kunden om dennes kunskaper och erfarenheter av den specifika tjänsten eller produkten samt om dennes ekonomiska situation och mål med investeringen, så att institutet kan rekommendera kunden de investeringstjänster och finansiella instrument som är lämpliga för denne.

Inhämtande av uppgifter vid övriga investeringstjänster

24 § Ett värdepappersinstitut skall, när det tillhandahåller någon annan investeringstjänst än dem som anges i 23 §, begära att kunden lämnar uppgifter om sina kunskaper och erfarenheter av den specifika tjänsten eller produkten, så att institutet kan bedöma om investeringstjänsten eller produkten passar kunden.

Ett värdepappersinstitut skall, om det mot bakgrund av de uppgifter som det har fått enligt första stycket anser att tjänsten eller produkten inte passar kunden, informera kunden om detta.

Ett värdepappersinstitut skall, om en kund inte lämnar uppgifter enligt första stycket eller lämnar ofullständiga uppgifter, informera kunden om att institutet inte kan avgöra om tjänsten eller produkten passar kunden.

Information enligt andra och tredje styckena får lämnas i standardiserad form.

25 § Ett värdepappersinstitut får tillhandahålla investeringstjänsterna mottagande och vidarebefordran av order i fråga om ett eller flera finan-

40

siella instrument och utförande av order avseende finansiella instrument på kunders uppdrag utan att uppfylla kraven i 24 §, om

1. tjänsten avser

a) aktier som tagits upp till handel på en reglerad marknad eller på en motsvarande marknad utanför EES,

b) penningmarknadsinstrument,

c) obligationer eller andra former av skuldförbindelser utan derivatinslag,

d) andelar i en värdepappersfond som avses i 1 kap. 1 § 21 lagen (2004:46) om investeringsfonder eller i ett fondföretag som avses i 1 kap. 7 § första stycket 1 samma lag, eller

e) andra okomplicerade finansiella instrument,

2. tjänsten tillhandahålls på kundens initiativ, samt

3. kunden klart och tydligt har informerats om att institutet inte kommer att bedöma om instrumentet eller tjänsten passar kunden.

Information enligt första stycket 3 får lämnas i standardiserad form.

Dokumentation av överenskommelser med kund

26 § Ett värdepappersinstitut skall dokumentera vad institutet och en kund har kommit överens om när det gäller parternas rättigheter och skyldigheter samt övriga villkor för de tjänster som institutet skall utföra för kunden.

Rapportering till kund

27 § Ett värdepappersinstitut skall lämna en tillfredsställande rapportering till en kund om de tjänster som institutet har utfört för kunden. Rapporteringen skall i förekommande fall innehålla uppgifter om kostnaderna för de transaktioner och tjänster som har utförts för kundens räkning.

Bästa utförande av kundorder

Bästa möjliga resultat

28 § När ett värdepappersinstitut utför en kunds order, skall det vidta alla rimliga åtgärder för att uppnå bästa möjliga resultat för kunden med avseende på

1. pris,

2. kostnad,

3. snabbhet,

4. sannolikhet för utförande och avveckling,

5. storlek,

6. art, och

7. andra för kunden väsentliga förhållanden. Om en kund har gett specifika instruktioner, skall ett värdepappersinstitut utföra ordern i enlighet med dessa.

41

Riktlinjer för utförande av order

29 § Ett värdepappersinstitut skall ha system och riktlinjer för hur institutet skall uppnå bästa möjliga resultat enligt 28 § när en kunds order utförs.

I riktlinjerna skall det för varje kategori av finansiella instrument finnas uppgifter om de olika handelsplatser där värdepappersinstitutet utför sina kundorder och de faktorer som påverkar valet av handelsplats. Riktlinjerna skall omfatta de handelsplatser som gör det möjligt för institutet att stadigvarande uppnå bästa möjliga resultat när en kundorder utförs.

Ett värdepappersinstitut skall övervaka och regelbundet uppdatera sina system och riktlinjer för utförande av order och informera sina kunder om varje väsentlig förändring av dessa.

30 § Innan ett värdepappersinstitut utför en kunds order, skall kunden ha godtagit de riktlinjer för utförande av order som institutet har.

31 § Innan ett värdepappersinstitut utför en kunds order utanför en reglerad marknad eller en handelsplattform, skall kunden ha gett sitt uttryckliga godkännande till det. Godkännandet kan ges generellt eller avse en enskild transaktion.

32 § Om en kund begär det, skall ett värdepappersinstitut kunna visa att det har utfört kundens order i enlighet med institutets riktlinjer för utförande av order.

Hantering av kundorder

33 § Ett värdepappersinstitut skall snabbt, effektivt och rättvist utföra en kunds order utan att denne missgynnas i förhållande till andra kunder eller på grund av institutets handel för egen räkning. I övrigt jämförbara kundorder skall utföras i den ordning som de togs emot, om det inte finns skäl för att utföra dem i en annan ordning.

Särskilt om kunders finansiella instrument och medel

34 § Ett värdepappersinstitut skall hålla en kunds finansiella instrument avskilda från institutets tillgångar, om inte kunden uttryckligen har godkänt något annat.

I 3 kap. lagen (1991:980) om handel med finansiella instrument finns det särskilda bestämmelser om förfoganden över finansiella instrument som tillhör någon annan. För överenskommelser enligt första stycket gäller dock inte 3 kap. 1 § samma lag.

35 § Ett värdepappersinstitut som innehar en kunds medel skall

1. vidta lämpliga åtgärder för att skydda kundens rättigheter, och

2. hålla medlen avskilda från institutets tillgångar, om det inte har tillstånd att ta emot medel på konto enligt 2 kap. 2 § första stycket 8 eller är ett kreditinstitut.

42

Ett värdepappersbolag och ett utländskt företag som tar emot medel med redovisningsskyldighet enligt 2 kap. 2 § första stycket 1 skall omedelbart avskilja medlen från de egna tillgångarna.

36 § Ett värdepappersbolag och ett utländskt företag som enligt 2 kap. 2 § första stycket 8 tar emot medel på konto skall ha en betalningsberedskap som är tillräcklig med hänsyn till rörelsens art och omfattning.

När medel tas emot på konto, skall en skriftlig överenskommelse om detta träffas med kunden.

Särskilt om kreditgivning

37 § Kredit enligt 2 kap. 2 § första stycket 2 får beviljas bara om låntagaren kan förväntas fullgöra låneförbindelsen. För kredit som lämnas skall det finnas betryggande säkerhet.

Lämnas aktier som säkerhet för kredit och ingår som en mindre del bland dessa även aktier i ett värdepappersbolag som lämnar krediten eller dess moderbolag, får värdepappersbolaget trots förbuden i 19 kap. 3 § aktiebolagslagen (2005:551) och 6 a kap. 2 § försäkringsrörelselagen (1982:713) som pant ta emot även dessa aktier.

38 § Vid kreditgivning enligt 2 kap. 2 § första stycket 2 gäller för värdepappersbolag bestämmelserna i denna paragraf och 37 § i stället för bestämmelserna i 21 kap. aktiebolagslagen (2005:551).

Ett värdepappersbolag får inte på andra villkor än sådana som bolaget normalt ställer upp lämna kredit till

1. en styrelseledamot,

2. en person som ensam eller i förening med någon annan får avgöra kreditärenden som skall avgöras av styrelsen,

3. en anställd som har en ledande ställning inom bolaget, 4. någon annan aktieägare än staten med ett aktieinnehav som motsvarar minst tre procent av hela aktiekapitalet,

5. den som är make eller sambo till någon som avses i 1–4, eller

6. en juridisk person i vilken någon som avses i 1–5 har ett väsentligt ekonomiskt intresse i egenskap av delägare eller medlem.

Finansinspektionen prövar efter ansökan om en anställd har sådan ledande ställning som avses i andra stycket 3.

Värdepappersbolagets styrelse skall avgöra ärenden om kredit till de personer och företag som avses i andra stycket. Bolaget skall föra in uppgifter om sådana krediter i en förteckning.

Andra–fjärde styckena tillämpas också på krediter mot säkerhet av borgen eller fordringsrätt som utfärdas av någon som avses i andra stycket. Detsamma gäller för en fordran som bolaget förvärvar och för vilken någon som avses i andra stycket är betalningsskyldig.

39 § Ett värdepappersbolag får ge förskott, lämna lån eller ställa säkerhet för lån i syfte att gäldenären skall förvärva aktier i bolaget eller ett överordnat bolag i samma koncern, bara om det därefter finns full täckning för det bundna egna kapitalet. Vid beräkningen av om det finns full täckning för det bundna egna kapitalet skall förskott och lån enligt

43

första meningen behandlas som fordringar utan värde samt säkerheter enligt första meningen behandlas som bolagets skuld.

Förskott, lån eller säkerhet får dock bara lämnas i den utsträckning det framstår som försvarligt med hänsyn till

1. de krav som verksamhetens art, omfattning och risker ställer på storleken av det egna kapitalet, och

2. bolagets konsolideringsbehov, likviditet och ställning i övrigt.

Undantag om det finns särskilda regler i EG-rätten

40 § Om ett värdepappersinstitut utför en investeringstjänst som bara är en del av en finansiell produkt för vilken det finns andra regler i EGrätten, gäller inte bestämmelserna i 22–27 §§.

Tillhandahållande av tjänster via ett annat företag

41 § Ett värdepappersinstitut som genom förmedling av ett annat värdepappersinstitut eller ett utländskt värdepappersföretag som hör hemma inom EES tar emot en instruktion om att utföra en investeringstjänst eller en sidotjänst för en kunds räkning, får förlita sig på de uppgifter om kunden som det har fått av det andra värdepappersinstitutet eller företaget och alla rekommendationer i fråga om tjänsten eller transaktionen som kunden har fått från det andra institutet eller företaget. Ett värdepappersinstitut som genomför en tjänst eller transaktion utifrån sådana uppgifter och rekommendationer ansvarar för att tjänsten eller transaktionen utförs i enlighet med bestämmelserna i detta kapitel.

Ett värdepappersinstitut som har förmedlat en instruktion till ett annat värdepappersinstitut eller ett utländskt värdepappersföretag ansvarar för att den information som det har lämnat över är fullständig och riktig och att de rekommendationer och den rådgivning som institutet har tillhandahållit är lämpliga för kunden.

Bemyndiganden

42 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om

1. vad ett värdepappersinstitut skall iaktta för att uppfylla skyldigheterna i 1 §,

2. vilka åtgärder som ett värdepappersbolag skall vidta för att uppfylla de krav på soliditet och likviditet, riskhantering och genomlysning samt riktlinjer och instruktioner som avses i 3–8 §§,

3. de riktlinjer, regler och rutiner ett värdepappersinstitut skall upprätta och tillämpa enligt 9 §,

4. vilka system, resurser och rutiner ett värdepappersinstitut skall ha enligt 10 §,

5. vad ett värdepappersinstitut skall iaktta för att uppfylla skyldigheterna i 11 §,

6. dokumentation enligt 12 §,

7. övervakning av handeln och kursbildningen enligt 13 §,

44

8. vad ett värdepappersinstitut skall iaktta och vilka krav som institutet skall uppfylla vid uppdragsavtal enligt 14 §,

9. vad ett värdepappersinstitut skall iaktta när det delar in sina kunder i kategorier enligt 15 §,

10. hantering av intressekonflikter enligt 21 §, 11. vilken information ett värdepappersinstitut skall lämna till sina kunder enligt 22 §,

12. vad ett värdepappersinstitut skall iaktta vid inhämtande av uppgifter från sina kunder enligt 23 och 24 §§,

13. vad ett värdepappersinstitut skall iaktta vid en prövning enligt 23 och 24 §§,

14. vilka finansiella instrument som skall anses vara okomplicerade enligt 25 § första stycket 1 e,

15. dokumentation och rapportering till kund enligt 26 och 27 §§, 16. vad ett värdepappersinstitut skall iaktta för att uppfylla kraven på att uppnå bästa möjliga resultat enligt 28 §,

17. riktlinjer för utförande av order enligt 29 §, 18. hantering av kunders order enligt 33 §, 19. hantering av finansiella instrument enligt 34 §, 20. hantering av medel enligt 35 §, 21. mottagande av medel på konto enligt 36 §, 22. vilka begränsningar som skall gälla vid ställande av säkerhet enligt 37 § andra stycket, och

23. vilka uppgifter som skall antecknas i en förteckning enligt 38 § fjärde stycket.

9 kap. Information om kurser och omsättningsuppgifter m.m.

Limitorder

1 § Om en kund har angett ett lägsta pris vid försäljning till tredje man eller ett högsta pris vid inköp (limit) avseende aktier som är upptagna till handel på en reglerad marknad och värdepappersinstitutet inte utför ordern, skall institutet omedelbart offentliggöra ordern på ett sätt som gör den lätt tillgänglig för övriga marknadsaktörer. Detta gäller dock inte om kunden har gett andra instruktioner.

Systematiska internhandlare

2 § Ett värdepappersinstitut är skyldigt att offentliggöra marknadsmässiga fasta bud med köp- eller säljpriser i de enligt artikel 22 i genomförandeförordningen likvida aktier som är upptagna till handel på en reglerad marknad och för vilka institutet är systematisk internhandlare. Offentliggörandet skall ske kontinuerligt och regelbundet under den tid då marknadsplatserna normalt är öppna och på ett sätt som på rimliga affärsmässiga villkor gör buden lätt tillgängliga för andra marknadsaktörer.

Skyldigheten enligt första stycket och ett instituts skyldigheter enligt 4 och 5 §§ gäller bara vid offentliggörande av bud upp till standardstorleken för den aktuella aktien.

45

3 § En systematisk internhandlare har rätt att när som helst ändra sina bud. Vid extraordinära marknadsförhållanden har internhandlaren också rätt att dra tillbaka buden.

4 § En systematisk internhandlare är skyldig att utföra en order till det offentliggjorda priset vid tidpunkten då ordern togs emot, om inte något annat följer av 5–8 §§ eller om detta skulle strida mot bestämmelsen om bästa orderutförande i 8 kap. 28 §.

5 § En systematisk internhandlare är inte skyldig att utföra en order som är större än något bud som internhandlaren har offentliggjort. Om internhandlaren ändå väljer att utföra ordern, skall den utföras till det pris som gäller för det största bud som internhandlaren har offentliggjort.

En systematisk internhandlare är inte heller skyldig att utföra en order som storleksmässigt ligger mellan två offentliggjorda bud. Om internhandlaren väljer att utföra ordern, skall den utföras till ett av de offentliggjorda priserna.

6 § En systematisk internhandlare har rätt att utföra en order till ett bättre pris för kunden än det offentliggjorda budet, om

1. ordern kommer från en professionell kund,

2. detta pris ligger inom ett intervall nära marknadsförhållandena, och

3. orderns storlek överstiger den storlek som är den vanliga för ickeprofessionella investerare enligt artikel 26 i genomförandeförordningen.

En systematisk internhandlare får därutöver utföra en order från en professionell kund till ett bättre pris än det offentliggjorda budet i fråga om transaktioner där utförande av ordern i olika värdepapper är en del av en enda transaktion eller i fråga om order som är underkastade andra villkor än det aktuella marknadspriset.

7 § En systematisk internhandlare har rätt att i enlighet med sina interna riktlinjer och på ett icke-diskriminerande sätt avgöra till vilka personer bud lämnas. Internhandlaren får även vägra att ingå, eller avbryta, affärsförbindelser med kunder på grundval av affärsmässiga överväganden.

8 § För att begränsa sin risk har en systematisk internhandlare rätt att på ett icke-diskriminerande sätt

1. begränsa antalet transaktioner med en och samma kund på de offentliggjorda villkoren, och

2. begränsa det totala antalet transaktioner med olika kunder vid samma tidpunkt om antalet eller volymen av orderna avsevärt överstiger det normala.

Information efter handel

9 § Ett värdepappersinstitut som har genomfört en transaktion med aktier som är upptagna till handel på en reglerad marknad skall offentliggöra information om pris, volym och tidpunkt för transaktionen.

46

Informationen skall göras tillgänglig för allmänheten så snart det kan ske och på rimliga affärsmässiga villkor.

Ett värdepappersinstitut som har genomfört en transaktion med finansiella instrument som antingen är upptagna till handel på en reglerad marknad men inte omfattas av första stycket eller som handlas på en handelsplattform skall offentliggöra information om transaktionen i den utsträckning som, med beaktande av verksamhetens art och omfattning, behövs för att säkra en god genomlysning.

Ett värdepappersinstitut har samma rätt som en reglerad marknad att fördröja offentliggörandet av information efter handel enligt föreskrifter meddelade med stöd av denna lag eller enligt beslut av en behörig myndighet i ett annat land inom EES.

Skyldigheten enligt första och andra styckena gäller inte om transaktionen har genomförts på en reglerad marknad eller en handelsplattform.

Bemyndiganden

10 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om

1. undantag från skyldigheten att offentliggöra en order enligt 1 §,

2. standardstorleken för likvida aktier upptagna till handel på en reglerad marknad,

3. skyldigheten att offentliggöra information enligt 9 § andra stycket, och

4. villkoren för att en aktie skall anses som likvid enligt artikel 22.1 andra stycket i genomförandeförordningen.

10 kap. Transaktionsrapportering m.m.

Tillämpningsområde

1 § Bestämmelserna i detta kapitel gäller

1. i fråga om svenska värdepappersinstitut, samtliga transaktioner som ett institut har utfört, utom sådana som har utförts vid en filial i ett annat land inom EES, och

2. i fråga om utländska värdepappersinstitut, samtliga transaktioner som ett institut har utfört vid en filial i Sverige.

Dokumentation och arkivering

2 § Ett värdepappersinstitut skall dokumentera samtliga relevanta uppgifter om transaktioner med finansiella instrument som institutet har utfört. Dokumentationen skall arkiveras i minst fem år.

Rapportering av transaktioner

3 § Ett värdepappersinstitut är ansvarigt för att uppgifter om de transaktioner som institutet har utfört, så snart som möjligt och senast vid slutet av följande arbetsdag, rapporteras till Finansinspektionen om

47

transaktionerna avser finansiella instrument som är upptagna till handel på en reglerad marknad.

Rapporten skall innehålla den information som anges i tabell 1 i bilaga I till genomförandeförordningen och uppgifter som identifierar den kund för vars räkning transaktionen har utförts.

4 § Rapporten enligt 3 § får lämnas till Finansinspektionen

1. av värdepappersinstitutet självt,

2. genom någon utomstående för institutets räkning,

3. genom ett ordermatchnings- eller rapportsystem som godkänts av Finansinspektionen, eller

4. genom den reglerade marknad eller handelsplattform där transaktionen utfördes.

Bemyndiganden

5 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om

1. dokumentation enligt 2 §, och

2. att rapporteringsskyldigheten enligt 3 § skall gälla också i fråga om transaktioner med finansiella instrument som inte är upptagna till handel på en reglerad marknad.

11 kap. Särskilda bestämmelser för en handelsplattform

Inledande bestämmelser

1 § En handelsplattform skall drivas hederligt, rättvist och professionellt och på ett sätt så att allmänhetens förtroende för värdepappersmarknaden upprätthålls.

När ett värdepappersinstitut driver en handelsplattform skall det tillämpa principerna om

1. fritt tillträde, som innebär att var och en som uppfyller de krav som ställs i denna lag och av institutet får delta i handeln,

2. neutralitet, som innebär att institutets regler för handelsplattformen tillämpas på ett likformigt sätt gentemot alla som deltar i handeln, och

3. god genomlysning, som innebär att deltagarna får en snabb, samtidig och korrekt information om handeln och att allmänheten får tillfälle att ta del av sådan information.

Av 13 kap. 12 § framgår att en börs efter Finansinspektionens tillstånd får driva en handelsplattform.

2 § Ett värdepappersinstitut som för egen räkning deltar i handeln på en handelsplattform som institutet självt driver skall inte därigenom anses ha utfört sådana investeringstjänster som avses i 2 kap. 1 § 1, 2 och 4.

Deltagare

3 § Ett värdepappersinstitut som driver en handelsplattform skall ha regler för vilka som får delta i handeln på denna. Som deltagare i handeln

48

får institutet ha Sveriges riksbank och Riksgäldskontoret samt fysiska och juridiska personer som har en betryggande kapitalstyrka, tillräckliga kunskaper och ändamålsenlig organisation av verksamheten och som i övrigt är lämpliga att delta i handeln.

Handelsregler

4 § Det skall finnas ändamålsenliga regler för handeln på en handelsplattform. Av reglerna skall framgå

1. deltagarnas förpliktelser mot den som driver handelsplattformen,

2. det som gäller för transaktioner på handelsplattformen, 3. vilka kriterier som används för att avgöra vilka finansiella instrument som får handlas på handelsplattformen, och

4. formerna för clearing och avveckling av de transaktioner som har genomförts.

5 § Ett värdepappersinstitut som driver en handelsplattform skall se till att information tillhandahålls om de finansiella instrument som handlas på handelsplattformen i en omfattning som är lämplig med hänsyn till de finansiella instrumentens art samt deltagarnas kunskaper och erfarenheter.

Utgivarens informationsplikt

6 § En utgivare av sådana överlåtbara värdepapper enligt 1 kap. 4 § första stycket 2 a eller b som efter ansökan av utgivare handlas på en handelsplattform skall

1. fortlöpande informera det värdepappersinstitut som driver handelsplattformen om sin verksamhet,

2. i övrigt lämna institutet de upplysningar som det behöver för att kunna fullgöra sina uppgifter enligt denna lag och andra författningar, samt

3. offentliggöra de upplysningar om sin verksamhet och värdepapperen som är av betydelse för bedömning av kursvärdet på värdepapperen.

7 § Utgivaren får skjuta upp offentliggörandet av sådan information som avses i 6 § 3, om

1. det finns godtagbara skäl,

2. allmänheten inte riskerar att vilseledas, och

3. utgivaren kan säkerställa att informationen inte röjs. Om utgivaren eller någon som handlar för utgivarens räkning lämnar ut informationen, skall den omedelbart överlämnas till värdepappersinstitutet samt offentliggöras, om inte mottagaren av informationen omfattas av tystnadsplikt enligt lag eller avtal.

8 § Ett värdepappersinstitut som driver en handelsplattform skall fortlöpande kontrollera att en utgivare av överlåtbara värdepapper enligt 6 § fullgör sin informationsskyldighet enligt denna lag.

49

Information före och efter handel

9 § Ett värdepappersinstitut som driver en handelsplattform skall offentliggöra information om de finansiella instrument som handlas på handelsplattformen, utom sådana som avses i 10 och 11 §§, i den utsträckning som, med hänsyn till verksamhetens art och omfattning, behövs för att säkra en god genomlysning. Informationen skall göras tillgänglig för allmänheten på rimliga affärsmässiga villkor.

10 § Värdepappersinstitutet skall offentliggöra köp- och säljbud samt orderdjup för aktier som handlas på handelsplattformen och som är upptagna till handel på en reglerad marknad. Informationen skall göras tillgänglig för allmänheten fortlöpande under den tid som marknaderna är öppna och på rimliga affärsmässiga villkor.

11 § Värdepappersinstitutet skall offentliggöra pris, volym och tidpunkt för de transaktioner som har genomförts på handelsplattformen med aktier som är upptagna till handel på en reglerad marknad. Informationen skall göras tillgänglig för allmänheten så snart det kan ske och på rimliga affärsmässiga villkor.

Bemyndiganden

12 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om skyldigheten att offentliggöra information

1. om handeln enligt 9 §,

2. före handel enligt 10 § och

3. efter handel enligt 11 §.

50

TREDJE AVDELNINGEN

Börsverksamhet m.m.

12 kap. Tillstånd att driva en reglerad marknad

Tillståndskrav

1 § För att som börs driva en reglerad marknad krävs tillstånd av Finansinspektionen. Tillstånd får ges svenska aktiebolag och svenska ekonomiska föreningar.

Tillstånd att driva en reglerad marknad får enligt 9 § även ges utländska företag.

Svenska företag

Förutsättningar för tillstånd

2 § Tillstånd att som börs driva en reglerad marknad skall ges ett svenskt aktiebolag eller en svensk ekonomisk förening, om

1. bolagsordningen eller stadgarna inte strider mot denna lag eller någon annan författning,

2. det finns skäl att anta att den planerade verksamheten kommer att drivas enligt bestämmelserna i denna lag och andra författningar som reglerar företagets verksamhet,

3. det finns skäl att anta att den som har eller kan förväntas komma att få ett kvalificerat innehav i företaget

a) inte kommer att motverka att verksamheten drivs på ett sätt som är förenligt med denna lag och andra författningar som reglerar företagets verksamhet, och

b) även i övrigt är lämplig att utöva ett väsentligt inflytande över ledningen av en börs,

4. den som skall ingå i företagets styrelse eller vara verkställande direktör, eller vara ersättare för någon av dem, har tillräcklig insikt och erfarenhet för att delta i ledningen av en börs och även i övrigt är lämplig för en sådan uppgift, och

5. företaget uppfyller de villkor i övrigt som anges i denna lag.

3 § Tillstånd enligt 2 § får inte ges, om någon som i väsentlig utsträckning har åsidosatt sina skyldigheter i näringsverksamhet eller andra ekonomiska angelägenheter eller gjort sig skyldig till allvarlig brottslighet har eller kan förväntas komma att få ett kvalificerat innehav i företaget.

Godkännande av bolagsordning m.m.

4 § Bolagsordningen eller stadgarna för en börs skall godkännas av Finansinspektionen i samband med att företaget får tillstånd att driva en reglerad marknad.

51

5 § En börs som har beslutat att ändra sin bolagsordning eller sina stadgar skall hos Finansinspektionen ansöka om godkännande av ändringen. Ändringen skall godkännas om bolagsordningen eller stadgarna stämmer överens med denna lag och andra författningar samt i övrigt innehåller de särskilda bestämmelser som behövs med hänsyn till omfattningen och arten av företagets verksamhet.

Ett beslut om ändring av bolagsordning eller stadgar får inte registreras innan ändringen har godkänts.

Styrelse

6 § En börs skall ha en styrelse med minst tre ledamöter. Börsen skall ha en verkställande direktör.

Aktiekapital m.m.

7 § En börs som är aktiebolag skall ha ett aktiekapital som med hänsyn till verksamhetens art och omfattning är tillräckligt stort. Vid bedömningen av om aktiekapitalet är tillräckligt skall hänsyn tas även till andra finansiella resurser som börsen har eller kan utnyttja. För en börs som är ekonomisk förening gäller det som sägs om aktiekapital i stället summan av gjorda medlemsinsatser och förlagsinsatser.

En börs som driver en handelsplattform skall ha ett startkapital enligt 3 kap. 6 § första stycket 2.

Ansökan om tillstånd

8 § Ansökan om tillstånd får göras innan bolaget eller föreningen har registrerats. Om en sådan ansökan har gjorts av ett aktiebolag inom sex månader från stiftelseurkundens undertecknande, räknas den i 2 kap. 22 § aktiebolagslagen (2005:551) föreskrivna tiden från tillståndsbeslutet. Om en sådan ansökan i stället har gjorts av en ekonomisk förening inom sex månader från det att beslut om att bilda föreningen fattats, räknas den i 2 kap. 3 § första stycket lagen (1987:667) om ekonomiska föreningar föreskrivna tiden från tillståndsbeslutet.

En ansökan skall innehålla en verksamhetsplan.

Utländska företag

9 § Tillstånd för ett utländskt företag att driva en reglerad marknad från filial i Sverige får ges om

1. företaget i sitt hemland driver sådan verksamhet och där står under tillsyn av en myndighet eller ett annat behörigt organ, och

2. det finns skäl att anta att den planerade verksamheten kommer att drivas enligt bestämmelserna i denna lag och föreskrifter som meddelats med stöd av lagen.

52

Svenska företags verksamhet utomlands

10 § En börs som avser att vidta åtgärder i ett annat land inom EES för att underlätta för deltagare på distans att få tillträde till börsens reglerade marknad eller till en handelsplattform som drivs av börsen, skall innan sådana åtgärder påbörjas underrätta Finansinspektionen. Finansinspektionen skall inom en månad från det att underrättelsen togs emot lämna över den till den behöriga myndigheten i det land där åtgärderna skall vidtas. På begäran skall Finansinspektionen till samma myndighet lämna uppgifter om vilka från det landet som deltar i handeln på en reglerad marknad eller handelsplattform.

Bemyndiganden

11 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om storleken av aktiekapitalet, summan av gjorda medlemsinsatser och förlagsinsatser samt kravet på startkapital enligt 7 §.

13 kap. Börsens verksamhet

Allmänna krav på verksamheten

1 § En börs skall driva sin verksamhet hederligt, rättvist och professionellt och på ett sätt så att allmänhetens förtroende för värdepappersmarknaden upprätthålls.

När börsen driver en reglerad marknad, skall den tillämpa principerna om

1. fritt tillträde, som innebär att var och en som uppfyller de krav som ställs i denna lag och av börsen får delta i handeln,

2. neutralitet, som innebär att börsens regler för den reglerade marknaden tillämpas på ett likformigt sätt gentemot alla som deltar i handeln, och

3. god genomlysning, som innebär att deltagarna får en snabb, samtidig och korrekt information om handeln och att allmänheten får tillfälle att ta del av sådan information.

En börs skall också

1. identifiera och hantera de risker som kan uppstå i verksamheten,

2. ha säkra tekniska system, samt

3. identifiera och hantera de intressekonflikter som kan uppstå mellan börsens eller dess ägares intressen och intresset av att en reglerad marknad drivs i enlighet med första och andra styckena.

2 § En börs skall ha en, i förhållande till den direkt affärsdrivande verksamheten, självständig övervakande funktion med tillräckliga resurser och befogenheter för att fullgöra börsens skyldigheter enligt 7 §, 14 kap. 7 §, 15 kap. 9 § och 16 kap. 13 §.

53

Godkännande för upptagande till handel

3 § Finansiella instrument får tas upp till handel på en reglerad marknad genom att börsen, efter prövning enligt 15 kap. 2 §, beslutar om upptagande till handel.

Om det finns en skyldighet enligt 2 kap. lagen (1991:980) om handel med finansiella instrument att upprätta ett prospekt, får handel med instrumentet inte inledas förrän

1. prospektet har godkänts och registrerats hos Finansinspektionen eller inspektionen har fått ett intyg som avses i 2 kap. 36 § samma lag, och

2. prospektet har offentliggjorts enligt den lagen.

4 § Överlåtbara värdepapper som har getts ut eller utfärdats av någon som enligt öppenhetsdirektivet har möjlighet att välja hemmedlemsstat får inte tas upp till handel på en reglerad marknad förrän emittenten har valt en stat inom EES som hemmedlemsstat.

Första stycket gäller inte i fråga om

1. andelar i en investeringsfond eller i ett sådant fondföretag som avses i 1 kap. 7 eller 9 § lagen (2004:46) om investeringsfonder, eller

2. penningmarknadsinstrument med kortare löptid än ett år.

5 § Överlåtbara värdepapper enligt 1 kap. 4 § första stycket 2 a eller b som har getts ut av ett företag som har tillstånd som börs får inte tas upp till handel på en reglerad marknad som drivs av den börsen.

Handelsregler och marknadsövervakning

6 § En börs skall ha ändamålsenliga regler för handeln på en reglerad marknad som drivs av börsen. Av reglerna skall framgå

1. deltagarnas förpliktelser mot börsen,

2. det som gäller för transaktioner på marknaden,

3. kompetenskraven för anställda och uppdragstagare hos deltagarna som deltar i handeln för deltagarnas räkning, och

4. formerna för clearing och avveckling av de transaktioner som har genomförts.

Reglerna får inte hindra en deltagare att välja ett system för avveckling av de transaktioner som genomförts på den reglerade marknaden under förutsättning att

1. förbindelserna mellan och avtalen rörande det valda avvecklingssystemet och varje annat system säkerställer en effektiv och ekonomisk avveckling av transaktionen, och

2. Finansinspektionen inte har beslutat att det valda avvecklingssystemet inte får användas för avveckling av transaktioner på den reglerade marknaden.

7 § Börsen skall övervaka handeln och kursbildningen vid den reglerade marknaden och se till att handeln sker i överensstämmelse med denna lag och andra författningar och god sed på värdepappersmarknaden.

54

Börsen är skyldig att på begäran av Finansinspektionen ge inspektionen åtkomst till sitt system för övervakningen av handeln och kursbildningen.

Regler om offentliga uppköpserbjudanden

8 § En börs skall ha regler om offentliga uppköpserbjudanden som avser aktier som är upptagna till handel på en reglerad marknad som drivs av börsen. Reglerna skall uppfylla de krav som ställs i Europaparlamentets och rådets direktiv 2004/25/EG av den 21 april 2004 om uppköpserbjudanden

TPF

8

FPT

i dess ursprungliga lydelse och i övrigt vara

ändamålsenliga.

Undantag från reglerna skall kunna beslutas av börsen eller ett av börsen utsett organ med representativa företrädare för näringslivet. Undantag får förenas med villkor. Ett beslut om undantag skall ange de skäl som det grundas på.

Information före och efter handel

9 § En börs skall offentliggöra information avseende de finansiella instrument som är upptagna till handel på den reglerade marknaden, utom sådana som avses i 10 och 11 §§, i den utsträckning som, med hänsyn till verksamhetens art och omfattning, behövs för att säkra en god genomlysning. Informationen skall göras tillgänglig för allmänheten på rimliga affärsmässiga villkor.

10 § En börs skall offentliggöra köp- och säljbud samt orderdjup för aktier som är upptagna till handel på den reglerade marknaden. Informationen skall göras tillgänglig för allmänheten fortlöpande under den tid som den reglerade marknaden är öppen och på rimliga affärsmässiga villkor.

11 § En börs skall offentliggöra pris, volym och tidpunkt för de transaktioner med aktier som har genomförts på den reglerade marknaden. Informationen skall göras tillgänglig för allmänheten så snart det kan ske och på rimliga affärsmässiga villkor.

Sidoverksamhet

12 § En börs får, utöver den verksamhet som tillståndet omfattar, på rimliga affärsmässiga villkor ge värdepappersinstitut och utländska värdepappersföretag tillträde till de funktioner inom den reglerade marknaden som används för att offentliggöra information enligt 9–11 §§. En börs får även driva annan verksamhet som har nära samband med den verksamhet som tillståndet omfattar.

En börs får också efter tillstånd av Finansinspektionen driva en handelsplattform. För den verksamheten gäller bestämmelserna i 7 § första stycket och 11 kap.

TP

8

PT

EUT L 142, 30.4.2004, s. 12 (Celex 32004L0025).

55

Om det finns särskilda skäl, får Finansinspektionen ge tillstånd till en börs att driva även annan verksamhet.

Tillstånd till förvärv av egendom i vissa fall

13 § En börs får bara efter tillstånd av Finansinspektionen förvärva egendom, om börsens motprestation motsvarar mer än 25 procent av dess kapitalbas. Tillstånd skall inhämtas före förvärvet.

Tillstånd skall ges om det inte kan antas att förvärvet leder till överträdelse av denna lag eller andra författningar.

Disciplinnämnd

14 § En börs skall ha en disciplinnämnd med uppgift att handlägga ärenden om deltagares och emittenters överträdelser av de regler som gäller vid en reglerad marknad som drivs av börsen (disciplinärenden).

Gäller ärendet ett företag som har ett kvalificerat innehav i börsen, är disciplinnämnden skyldig att pröva ärendet, om Finansinspektionen begär det.

Om det finns särskilda skäl, får Finansinspektionen besluta att en börs inte behöver ha en disciplinnämnd.

15 § En disciplinnämnd skall bestå av en ordförande, en vice ordförande och minst tre övriga ledamöter. Ordföranden och vice ordföranden skall vara lagfarna och erfarna som domare. Av övriga ledamöter skall minst två vara väl insatta i förhållandena på värdepappersmarknaden.

I disciplinnämnden får det inte ingå personer som har anställning i börsen, i ett företag som har ett kvalificerat innehav i börsen eller i ett företag som ingår i samma koncern. I nämnden får det inte heller ingå personer som har ett kvalificerat och stadigvarande uppdrag för börsen, för ett företag som har ett kvalificerat innehav i börsen eller för ett företag som ingår i samma koncern.

16 § För ledamöterna i en disciplinnämnd tillämpas det som sägs i 11 och 12 §§förvaltningslagen (1986:223) om jäv.

Bemyndiganden

17 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om

1. övervakningen av handeln och kursbildningen enligt 7 §,

2. handelsregler för en reglerad marknad i fråga om aktiebolags förvärv och överlåtelse av egna aktier vid den reglerade marknaden,

3. börsens skyldighet enligt 9 § att offentliggöra information om handeln,

4. skyldigheten enligt 10 § att offentliggöra information före handel,

5. skyldigheten enligt 11 § att offentliggöra information efter handel, och

6. disciplinnämnd och handläggningen av disciplinärenden.

56

14 kap. Deltagare i handeln på en reglerad marknad

Krav på den som deltar i handeln på en reglerad marknad

1 § En börs skall ha regler för vilka som får delta i handeln på en reglerad marknad.

2 § Som deltagare i handeln på en reglerad marknad får en börs ha Sveriges riksbank och Riksgäldskontoret samt fysiska och juridiska personer som har en betryggande kapitalstyrka, ändamålsenlig organisation av verksamheten, nödvändiga riskhanteringsrutiner, säkra tekniska system och som i övrigt är lämpliga att delta i handeln vid den reglerade marknaden.

3 § En deltagare på en reglerad marknad får handla för egen räkning. En börs får tillåta följande institut och företag att delta i handeln vid en reglerad marknad för någon annans räkning:

1. värdepappersinstitut som har tillstånd att driva värdepappersrörelse enligt 2 kap. 1 § 2, och

2. utländska företag som i sitt hemland får driva sådan verksamhet som avses i 1 och som där står under betryggande tillsyn av myndighet eller annat behörigt organ.

Om ett företag inom en koncern bedriver handel uteslutande för egen och för andra koncernföretags räkning skall den handel som företaget bedriver anses vara handel för egen räkning vid tillämpning av första stycket.

4 § Om en deltagare inte längre uppfyller kraven för att delta i handeln på den reglerade marknaden, skall börsen besluta att deltagaren inte längre får delta i handeln.

Börsen får förena beslutet med de villkor som anses nödvändiga för att säkerställa en ordnad avveckling av deltagarens förpliktelser och för att skydda investerare mot förlust.

Upplysningsskyldighet och övervakning

5 § En deltagare i handeln på en reglerad marknad skall lämna börsen de upplysningar som behövs för att börsen skall kunna fullgöra sina uppgifter enligt denna lag och andra författningar.

6 § En deltagare som inte står under Finansinspektionens tillsyn är skyldig att på begäran av inspektionen lämna uppgifter om förhållanden som rör deltagandet i handeln på den reglerade marknaden. Inspektionen får förelägga en sådan deltagare att lämna de begärda uppgifterna.

Om Finansinspektionen riktat en begäran eller ett föreläggande enligt första stycket till en deltagare som står under tillsyn av en behörig myndighet i ett annat land inom EES, skall inspektionen informera den myndigheten.

7 § En börs skall övervaka att deltagarna följer de krav som gäller för deltagande i handeln på den reglerade marknaden.

57

Bemyndigande

8 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om övervakningen av deltagarna i handeln på en reglerad marknad.

15 kap. Upptagande av finansiella instrument till handel, m.m.

Förutsättningar för upptagande till handel

1 § En börs skall ha tydliga och öppet redovisade regler för upptagande av finansiella instrument till handel på en reglerad marknad.

2 § Finansiella instrument får tas upp till handel på en reglerad marknad bara om det finns förutsättningar för en rättvis, välordnad och effektiv handel med de finansiella instrumenten och de, när det är fråga om överlåtbara värdepapper, är fritt överlåtbara.

Optioner och terminer får tas upp till handel på en reglerad marknad bara om det finns förutsättningar för en tillförlitlig kurssättning och effektiv avveckling.

3 § Finansiella instrument får tas upp till handel efter ansökan av emittenten.

4 § Ett finansiellt instrument får tas upp till handel utan att emittenten har ansökt om det, om

1. instrumentet är ett överlåtbart värdepapper som redan har tagits upp till handel på en annan reglerad marknad, eller

2. instrumentet inte är ett överlåtbart värdepapper.

5 § Om ett finansiellt instrument har tagits upp till handel enligt 4 §, skall börsen underrätta emittenten av instrumentet.

Emittentens informationsplikt m.m.

6 § Om överlåtbara värdepapper enligt 1 kap. 4 § första stycket 2 a eller b har tagits upp till handel på en reglerad marknad efter ansökan av utgivaren eller om denne lämnat in en ansökan om upptagande till handel, gäller följande. Utgivaren skall

1. fortlöpande informera börsen om sin verksamhet,

2. i övrigt lämna börsen de upplysningar som den behöver för att kunna fullgöra sina uppgifter enligt denna lag och andra författningar, och

3. offentliggöra de upplysningar om sin verksamhet och värdepapperen som är av betydelse för bedömning av kursvärdet på värdepapperen.

Om ett företag som har ett kvalificerat innehav i en börs har gett ut överlåtbara värdepapper enligt 1 kap. 4 § första stycket 2 a eller b som har tagits upp till handel på en reglerad marknad som drivs av börsen, skall börsen omedelbart vidarebefordra information enligt första stycket till Finansinspektionen.

58

7 § Utgivaren får skjuta upp offentliggörandet av sådan information som avses i 6 § första stycket 3, om

1. det finns godtagbara skäl,

2. allmänheten inte riskerar att vilseledas, och

3. utgivaren kan säkerställa att informationen inte röjs. Om utgivaren eller någon som handlar för utgivarens räkning lämnar ut informationen, skall den omedelbart överlämnas till börsen samt offentliggöras, om inte mottagaren av informationen omfattas av tystnadsplikt enligt lag eller avtal.

8 § En emittent av överlåtbara värdepapper som efter ansökan av emittenten har tagits upp till handel på en reglerad marknad, skall omedelbart offentliggöra

1. alla förändringar i de rättigheter som är knutna till värdepapperen, och

2. nya låneemissioner. Nya låneemissioner behöver dock inte offentliggöras av sådana emittenter som avses i 16 kap. 2 § 1–3.

Om den som har gett ut aktier som har tagits upp till handel på en reglerad marknad även har utfärdat derivatinstrument med aktierna som underliggande tillgång, skall utgivaren omedelbart även offentliggöra förändringar i de rättigheter som är knutna till derivatinstrumenten.

9 § En börs skall fortlöpande kontrollera att de finansiella instrument som är upptagna till handel uppfyller kraven i 2 § samt att emittenter fullgör sina informationsskyldigheter enligt denna lag.

10 § En börs skall vidta åtgärder för att underlätta för deltagarna i handeln på en reglerad marknad att inhämta sådan information om emittenterna som offentliggjorts enligt lag eller annan författning.

Avnotering

11 § En börs skall avslå en begäran om upptagande till handel eller besluta att ett finansiellt instrument inte längre skall vara upptaget till handel (avnotering), om instrumentet inte uppfyller de krav som gäller för upptagande till handel eller om emittenten allvarligt åsidosätter sina förpliktelser enligt denna lag eller någon annan författning. Avnotering av ett finansiellt instrument som har tagits upp till handel skall även ske på begäran av den efter vars begäran instrumentet har tagits upp till handel. Om det är lämpligt från allmän synpunkt, får avnotering skjutas upp.

Avnotering får inte beslutas utan att emittenten har fått tillfälle att yttra sig över det som har tillförts ärendet genom någon annan än emittenten själv, om det inte är uppenbart obehövligt eller om beslutet inte kan skjutas upp.

En börs skall omedelbart offentliggöra ett beslut om avnotering och informera Finansinspektionen om beslutet. Inspektionen skall därefter underrätta övriga behöriga myndigheter inom EES om beslutet.

59

Inregistrering

12 § Om en börs erbjuder inregistrering vid en reglerad marknad får överlåtbara värdepapper enligt 1 kap. 4 § första stycket 2 a eller b, som har tagits upp till handel på marknaden, inregistreras där efter ansökan av utgivaren.

Inregistrering får ske bara om det med hänsyn till marknadsförhållandena för de överlåtbara värdepapperen och omständigheterna i övrigt finns förutsättningar för en ändamålsenlig handel med dem.

13 § En börs får inte avslå en sådan begäran som avses i 12 § utan att sökanden har fått tillfälle att yttra sig över det som har tillförts ärendet genom någon annan än sökanden själv, om det inte är uppenbart obehövligt.

Beslut om inregistrering skall meddelas snarast och senast sex månader från det att begäran gjordes hos börsen eller, om begäran kompletteras, senast sex månader från det att kompletteringen kom in till börsen. Meddelas inte beslut inom angiven tid, skall begäran anses ha avslagits.

14 § En börs skall avslå en begäran om inregistrering eller besluta om avregistrering av ett finansiellt instrument, om instrumentet inte uppfyller de krav som gäller för inregistrering eller om utgivaren allvarligt åsidosätter sina förpliktelser enligt denna lag eller någon annan författning. Avregistrering av ett finansiellt instrument skall även ske på begäran av utgivaren. Om det är lämpligt från allmän synpunkt, får avregistrering skjutas upp.

Avregistrering får inte beslutas utan att utgivaren har fått tillfälle att yttra sig över det som har tillförts ärendet genom någon annan än utgivaren själv, om det inte är uppenbart obehövligt eller om beslutet inte kan skjutas upp.

Beslut om avregistrering skall offentliggöras omedelbart.

Bemyndiganden

15 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om

1. börsens övervakning enligt 9 §, och

2. villkoren för inregistrering enligt 12 §.

16 kap. Regelbunden finansiell information

Tillämpningsområde

1 § Bestämmelserna i detta kapitel gäller för en emittent som har Sverige som hemmedlemsstat och vars överlåtbara värdepapper är upptagna till handel på en reglerad marknad.

Särskilda bestämmelser om emittenter som inte har säte i en stat inom EES finns i 11 §.

60

En emittent som inte har Sverige som hemmedlemsstat skall, om emittentens överlåtbara värdepapper efter ansökan av emittenten är upptagna till handel på en reglerad marknad i Sverige, offentliggöra regelbunden finansiell information i enlighet med den offentliga reglering i emittentens hemmedlemsstat inom EES som följer av öppenhetsdirektivet.

2 § Bestämmelserna i detta kapitel skall inte tillämpas om emittenten är

1. en stat,

2. ett landsting eller en kommun eller en motsvarande regional eller lokal myndighet i en stat,

3. en mellanstatlig organisation i vilken en eller flera stater inom EES är medlemmar,

4. Europeiska centralbanken, eller

5. en centralbank i en stat inom EES.

3 § Bestämmelserna i detta kapitel skall inte tillämpas i fråga om

1. andelar i en investeringsfond eller i ett sådant fondföretag som avses i 1 kap. 7 eller 9 § lagen (2004:46) om investeringsfonder,

2. penningmarknadsinstrument med en kortare löptid än ett år, eller

3. obligationer eller andra överlåtbara skuldförbindelser som var och en har ett nominellt värde motsvarande minst 50 000 euro och som inte är av sådant slag som anges i 18 kap. 2 § första stycket 1.

Års- och koncernredovisning

4 § Emittenten skall så snart som möjligt och senast fyra månader efter utgången av varje räkenskapsår offentliggöra sin årsredovisning och, i förekommande fall, en koncernredovisning.

Års- och koncernredovisningar skall vara granskade av emittentens revisor. Revisionsberättelsen skall offentliggöras tillsammans med års- och koncernredovisningen. Bestämmelser om revision finns i 10 kap. försäkringsrörelselagen (1982:713), 4 a kap. sparbankslagen (1987:619), 8 kap. lagen (1987:667) om ekonomiska föreningar, 7 a kap. lagen (1995:1570) om medlemsbanker, revisionslagen (1999:1079) och 9 kap. aktiebolagslagen (2005:551).

Halvårsrapport

5 § En utgivare av aktier eller av obligationer eller andra överlåtbara skuldförbindelser som inte är av sådant slag som anges i 18 kap. 2 § första stycket 1 skall offentliggöra en delårsrapport för räkenskapsårets första sex månader (halvårsrapport). Halvårsrapporten skall offentliggöras så snart som möjligt och senast två månader efter rapportperiodens utgång.

Delårsredogörelse

6 § En utgivare av aktier skall offentliggöra en delårsredogörelse under räkenskapsårets första och andra halvår. Redogörelsen skall

61

offentliggöras tidigast tio veckor efter början och senast sex veckor före slutet av halvåret.

En delårsredogörelse skall innehålla information om perioden mellan halvårets början och dagen för redogörelsens offentliggörande. I redogörelsen skall det ingå uppgifter om väsentliga händelser och transaktioner under perioden samt en allmän beskrivning av utgivarens och dess dotterföretags ställning och resultat under perioden.

Kvartalsrapport

7 § Det krävs ingen delårsredogörelse enligt 6 § om utgivaren i stället offentliggör en delårsrapport för perioden från halvårets början och tre månader framåt (kvartalsrapport). Kvartalsrapporten skall offentliggöras så snart som möjligt och senast två månader efter rapportperiodens utgång.

Innehållet i års- och koncernredovisning samt delårsrapport

8 § För emittenter med säte i Sverige finns bestämmelser om års- och koncernredovisning samt delårsrapport i årsredovisningslagen (1995:1554), lagen (1995:1559) om årsredovisning i kreditinstitut och värdepappersbolag och lagen (1995:1560) om årsredovisning i försäkringsföretag.

I fråga om koncernredovisning gäller därutöver Europaparlamentets och rådets förordning (EG) nr 1606/2002 av den 19 juli 2002 om tillämpning av internationella redovisningsstandarder

TPF

9

FPT

.

Undertecknande och intygande

9 § De som skall underteckna en årsredovisning respektive en koncernredovisning skall i anslutning till underskrifterna ange sin befattning hos emittenten.

Om det är fråga om en årsredovisning, skall undertecknarna omedelbart före underskrifterna lämna en försäkran att årsredovisningen har upprättats i enlighet med god redovisningssed och ger en rättvisande bild av företagets ställning och resultat samt att förvaltningsberättelsen ger en rättvisande översikt över utvecklingen av företagets verksamhet, ställning och resultat samt beskriver väsentliga risker och osäkerhetsfaktorer som företaget står inför.

Om det är fråga om en koncernredovisning, skall undertecknarna omedelbart före underskrifterna lämna en försäkran att koncernredovisningen har upprättats i enlighet med de internationella redovisningsstandarder som avses i Europaparlamentets och rådets förordning (EG) nr 1606/2002 av den 19 juli 2002 om tillämpning av internationella redovisningsstandarder och ger en rättvisande bild av koncernens ställning och resultat samt att koncernförvaltningsberättelsen ger en rättvisande översikt över utvecklingen av koncernens verksamhet,

TP

9

PT

EGT L 243, 11.9.2002, s. 1 (Celex 32002R1606).

62

ställning och resultat samt beskriver väsentliga risker och osäkerhetsfaktorer som de företag som ingår i koncernen står inför.

10 § En halvårsrapport skall undertecknas med tillämpning av 2 kap. 7 § årsredovisningslagen (1995:1554).

De som undertecknar en halvårsrapport skall i anslutning till underskrifterna ange sin befattning hos utgivaren. De skall även omedelbart före underskrifterna lämna en försäkran om att halvårsrapporten ger en rättvisande översikt av företagets och, i förekommande fall, koncernens verksamhet, ställning och resultat samt beskriver väsentliga risker och osäkerhetsfaktorer som företaget och de företag som ingår i koncernen står inför.

Emittenter utan säte i en stat inom EES

11 § En emittent som inte har säte i en stat inom EES får tillämpa sådana bestämmelser om års- och koncernredovisning samt halvårsrapport som finns i en offentlig reglering i en stat utanför EES, om dessa bestämmelser motsvarar de krav som ställs på sådan regelbunden finansiell information i öppenhetsdirektivet. Emittenten får även tillämpa ett tredjelands bestämmelser om kvartalsrapport, om dessa bestämmelser motsvarar de krav på sådan rapport som ställs i de bestämmelser om delårsrapport som anges i 8 § och som skulle ha varit tillämpliga om emittenten hade haft sitt säte i Sverige.

En emittent som inte har säte i en stat inom EES får även tillämpa sådana bestämmelser om koncernredovisning och halvårsrapport för koncernen som finns i en offentlig reglering i en stat utanför EES, om villkoren i artikel 1 i kommissionens beslut nr 891/2006/EG av den 4 december 2006 om tillämpningen av internationella redovisningsstandarder för tredjelandemittenter av värdepapper

TPF

10

FPT

är

uppfyllda.

Om ett tredjelands bestämmelser enligt första stycket inte anses likvärdiga eller om villkoren enligt andra stycket inte är uppfyllda, skall emittenten upprätta års- och koncernredovisning, halvårsrapport respektive kvartalsrapport i enlighet med de bestämmelser som anges i 8 § och som gäller för en emittent av motsvarande slag.

Ingivande av information till en börs

12 § En emittent av överlåtbara värdepapper som efter ansökan av emittenten är upptagna till handel på en reglerad marknad i Sverige, skall vid offentliggörandet av den information som avses i 4–7 §§ samtidigt lämna informationen till den börs som driver den reglerade marknaden.

Övervakning av regelbunden finansiell information

13 § En börs skall övervaka att den som har Sverige som hemmedlemsstat och som har gett ut eller utfärdat överlåtbara

TP

10

PT

EUT L 343, 8.12.2006, s. 96 (Celex 32006D0891).

63

värdepapper som efter ansökan av emittenten är upptagna till handel på en reglerad marknad som drivs av börsen, upprättar sådan regelbunden finansiell information som anges i 4, 5 och 7 §§ i enlighet med de bestämmelser som gäller för emittenten.

14 § Om börsen finner att de bestämmelser som gäller för upprättandet av regelbunden finansiell information har överträtts, skall börsen anmäla detta till Finansinspektionen.

En anmälan behöver inte göras om emittenten på börsens uppmaning offentliggjort rättad eller kompletterad information.

15 § En börs skall regelbundet rapportera till Finansinspektionen om övervakningen enligt 13 §.

Bemyndiganden

16 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om

1. vilka krav ett tredjelands bestämmelser skall uppfylla för att få tillämpas enligt 11 § första stycket,

2. övervakningen av regelbunden finansiell information vid en börs enligt 13 §, och

3. innehållet, omfattningen och fullgörandet av rapporteringen enligt 15 §.

17 kap. Gemensamma bestämmelser om information som skall offentliggöras av emittenter

Tillämpningsområde

1 § En emittent av överlåtbara värdepapper som har Sverige som hemmedlemsstat, skall tillämpa bestämmelserna i detta kapitel för sådan information som skall offentliggöras enligt 15 kap. 6 § första stycket 3 och 8 § samt 16 kap.

En emittent av överlåtbara värdepapper som inte har Sverige som hemmedlemsstat skall, om värdepapperen är upptagna till handel på en reglerad marknad i Sverige, tillämpa de bestämmelser som har meddelats med stöd av 5 § första stycket 2 för sådan information som skall offentliggöras enligt 15 kap. 6 § första stycket 3 och 8 § samt 16 kap. 1 § tredje stycket. Om en sådan emittents överlåtbara värdepapper inte är upptagna till handel på en reglerad marknad i emittentens hemmedlemsstat, skall emittenten dessutom tillämpa 2 §.

Offentliggörande av information

2 § Informationen skall offentliggöras så att den snabbt och på ett ickediskriminerande sätt blir tillgänglig för allmänheten inom EES.

64

Information till Finansinspektionen

3 § Information som offentliggörs skall samtidigt lämnas till Finansinspektionen.

Lagring av informationen

4 § Finansinspektionen skall se till att det finns en lagringsfunktion där information som lämnas till inspektionen enligt 3 § lagras elektroniskt.

Informationen skall vara lätt tillgänglig för den som vill ta del av den.

Bemyndiganden

5 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om

1. hur offentliggörandet enligt 2 § skall ske, och

2. på vilket språk informationen skall offentliggöras. Regeringen får meddela föreskrifter om lagringsfunktionen enligt 4 §.

18 kap. Övriga krav på utgivare

Särskilda bestämmelser om aktier

1 § En utgivare av aktier som efter ansökan av utgivaren är upptagna till handel på en reglerad marknad i Sverige skall utse ett finansiellt institut genom vilket aktieägarna skall kunna utöva sina finansiella rättigheter.

Särskilda bestämmelser om skuldebrev

2 § I 3–6 §§ avses med skuldebrev obligationer och andra överlåtbara skuldförbindelser, med undantag för sådana som

1. om de konverteras eller om de rättigheter som de medför utövas, ger rätt att förvärva aktier eller finansiella instrument som kan jämställas med aktier, eller

2. utgörs av penningmarknadsinstrument med kortare löptid än ett år. Bestämmelserna i 3–6 §§ skall tillämpas i fråga om skuldebrev som efter ansökan av utgivaren är upptagna till handel på en reglerad marknad i Sverige.

Bestämmelserna i 4–6 §§ skall inte tillämpas i fråga om skuldebrev som har getts ut av en stat inom EES eller av ett landsting eller en kommun eller motsvarande regional eller lokal myndighet inom EES.

I 8 § finns bestämmelser om undantag från 3–6 §§ för vissa utgivare som inte har säte i en stat inom EES.

3 § En utgivare av skuldebrev skall se till att alla innehavare av sådana skuldebrev som har getts ut samtidigt och på samma villkor behandlas lika när det gäller de rättigheter som är knutna till skuldebreven.

65

4 § En utgivare av skuldebrev får inte hindra innehavare av skuldebreven från att utöva sina rättigheter genom en fullmakt till någon annan.

Om utgivaren av skuldebreven inte har sitt säte i Sverige, gäller första stycket bara om lagstiftningen i den stat där utgivaren har sin hemvist tillåter en sådan fullmakt.

5 § Om en utgivare av skuldebrev avser att hålla ett möte med innehavare av skuldebreven, skall utgivaren

1. informera skuldebrevsinnehavarna om plats, tid och dagordning för mötet samt om vad som krävs för att en innehavare skall ha rätt att delta i mötet, och

2. tillhandahålla skuldebrevsinnehavarna ett fullmaktsformulär. Fullmaktsformuläret skall tillhandahållas tillsammans med kallelsen till mötet, om kallelsen sänds till skuldebrevsinnehavarna. Om kallelse sker på något annat sätt, skall fullmaktsformuläret tillhandahållas skuldebrevsinnehavarna på begäran efter det att mötet har tillkännagetts.

6 § En utgivare av skuldebrev skall informera skuldebrevsinnehavarna om utbetalning av ränta, utövande av rättigheter avseende konvertering, utbyte, teckning eller annullering och återbetalning.

Utgivaren skall utse ett finansiellt institut genom vilket skuldebrevsinnehavarna skall kunna utöva sina finansiella rättigheter.

Utgivare utan säte i en stat inom EES

7 § Bestämmelserna i 8–12 §§ är tillämpliga på den som har gett ut där angivna överlåtbara värdepapper som är upptagna till handel på en reglerad marknad i Sverige, om utgivaren inte har säte i en stat inom EES och har Sverige som hemmedlemsstat.

8 § En utgivare av skuldebrev behöver inte tillämpa bestämmelserna i 3– 6 §§, om utgivaren uppfyller de krav som uppställs i en offentlig reglering i en stat utanför EES och som motsvarar dessa bestämmelser.

9 § En utgivare av aktier behöver inte tillämpa bestämmelserna i 10– 12 §§, om utgivaren uppfyller de krav som uppställs i en offentlig reglering i en stat utanför EES och som motsvarar dessa bestämmelser.

10 § En utgivare av aktier skall behandla alla aktieägare som innehar aktier av samma slag lika.

11 § Inför en bolagsstämma skall en utgivare av aktier informera aktieägarna om

1. plats, tid och dagordning för stämman,

2. det totala antalet aktier och rösträtter, och

3. aktieägares rätt att delta i stämman.

12 § En utgivare av aktier får inte hindra aktieägare från att utöva sina rättigheter genom en fullmakt till någon annan, om lagstiftningen i den stat där utgivaren har sin hemvist tillåter att en sådan fullmakt används.

66

Om fullmakt får användas, skall utgivaren inför en bolagsstämma tillhandahålla ett fullmaktsformulär till dem som har rätt att rösta vid stämman.

67

FJÄRDE AVDELNINGEN

Clearingverksamhet

19 kap. Tillstånd för clearingverksamhet

Tillståndskrav

1 § För att yrkesmässigt driva clearingverksamhet krävs tillstånd av Finansinspektionen. Tillstånd får ges svenska aktiebolag, svenska ekonomiska föreningar och utländska företag.

2 § Tillstånd enligt 1 § behövs dock inte för

1. Sveriges riksbank,

2. clearingverksamhet som huvudsakligen allmänheten deltar i, 3. företag som har tillstånd att driva bankrörelse enligt lagen (2004:297) om bank- och finansieringsrörelse, och

4. företag som har tillstånd enligt 2 kap. 1 § 1, 2, 4 eller 8.

Svenska företag

Förutsättningar för tillstånd

3 § Tillstånd att driva clearingverksamhet skall ges ett svenskt aktiebolag eller en svensk ekonomisk förening, om

1. bolagsordningen eller stadgarna inte strider mot denna lag eller någon annan författning,

2. det finns skäl att anta att den planerade verksamheten kommer att drivas enligt bestämmelserna i denna lag och andra författningar som reglerar företagets verksamhet,

3. det finns skäl att anta att den som har eller kan förväntas komma att få ett kvalificerat innehav i företaget

a) inte kommer att motverka att verksamheten drivs på ett sätt som är förenligt med denna lag och andra författningar som reglerar företagets verksamhet, och

b) även i övrigt är lämplig att utöva ett väsentligt inflytande över ledningen av en clearingorganisation,

4. den som skall ingå i företagets styrelse eller vara verkställande direktör, eller vara ersättare för någon av dem, har tillräcklig insikt och erfarenhet för att delta i ledningen av en clearingorganisation och även i övrigt är lämplig för en sådan uppgift, och

5. företaget uppfyller de villkor i övrigt som anges i denna lag.

4 § Tillstånd enligt 3 § får inte ges, om någon som i väsentlig utsträckning har åsidosatt sina skyldigheter i näringsverksamhet eller andra ekonomiska angelägenheter eller gjort sig skyldig till allvarlig brottslighet har eller kan förväntas komma att få ett kvalificerat innehav i företaget.

68

Godkännande av bolagsordning m.m.

5 § Bolagsordningen eller stadgarna för en clearingorganisation skall godkännas av Finansinspektionen i samband med att företaget får tillstånd att driva clearingverksamhet.

6 § En clearingorganisation som har beslutat att ändra sin bolagsordning eller sina stadgar skall hos Finansinspektionen ansöka om godkännande av ändringen. Ändringen skall godkännas om bolagsordningen eller stadgarna stämmer överens med denna lag och andra författningar samt i övrigt innehåller de särskilda bestämmelser som behövs med hänsyn till omfattningen och arten av företagets verksamhet.

Ett beslut om ändring av bolagsordning eller stadgar får inte registreras innan ändringen har godkänts.

Styrelse

7 § En clearingorganisation skall ha en styrelse med minst tre ledamöter. Organisationen skall ha en verkställande direktör.

Aktiekapital m.m.

8 § En clearingorganisation som är aktiebolag skall ha ett aktiekapital som med hänsyn till verksamhetens art och omfattning är tillräckligt stort. Vid bedömningen av om aktiekapitalet är tillräckligt skall hänsyn tas även till andra finansiella resurser som bolaget har eller kan utnyttja. För en clearingorganisation som är ekonomisk förening gäller det som sägs om aktiekapital i stället summan av gjorda medlemsinsatser och förlagsinsatser.

9 § En clearingorganisation skall genom eget kapital, garanti eller försäkring eller på annat liknande sätt ha en tillfredsställande beredskap att uppfylla ett sådant betalningsansvar som kan uppkomma för organisationen till följd av clearingverksamheten.

Ansökan om tillstånd

10 § Ansökan om tillstånd får göras innan bolaget eller föreningen har registrerats. Om en sådan ansökan har gjorts av ett aktiebolag inom sex månader från stiftelseurkundens undertecknande, räknas den i 2 kap. 22 § aktiebolagslagen (2005:551) föreskrivna tiden från tillståndsbeslutet. Om en sådan ansökan i stället har gjorts av en ekonomisk förening inom sex månader från det att beslut om att bilda föreningen fattats, räknas den i 2 kap. 3 § första stycket lagen (1987:667) om ekonomiska föreningar föreskrivna tiden från tillståndsbeslutet.

11 § En ansökan om tillstånd skall innehålla en verksamhetsplan för den avsedda verksamheten. I planen skall företaget beskriva de huvudsakliga risker som är förenade med verksamheten och hur dessa risker skall hanteras.

69

Utländska företag

12 § Tillstånd för ett utländskt företag att driva clearingverksamhet från filial i Sverige får ges om

1. företaget i sitt hemland driver sådan verksamhet och där står under tillsyn av en myndighet eller ett annat behörigt organ, och

2. det finns skäl att anta att den planerade verksamheten kommer att drivas enligt bestämmelserna i denna lag och föreskrifter som meddelats med stöd av lagen.

Bemyndigande

13 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om storleken av aktiekapitalet och summan av gjorda medlemsinsatser och förlagsinsatser enligt 8 §.

20 kap. Clearingorganisationens verksamhet

Inledande bestämmelse

1 § En clearingorganisation skall driva sin verksamhet hederligt, rättvist och professionellt och på ett sätt så att allmänhetens förtroende för värdepappersmarknaden upprätthålls. En clearingorganisation skall tillgodose de säkerhetskrav som är förenade med verksamheten.

Clearingorganisationen skall i verksamheten tillämpa principerna om

1. fritt tillträde, som innebär att var och en som uppfyller de krav som ställs i denna lag och av clearingorganisationen får delta i clearingen, och

2. neutralitet, som innebär att clearingorganisationens regler tillämpas på ett likformigt sätt gentemot alla clearingdeltagare.

Krav på organisation av verksamheten

Krav på regelverk m.m.

2 § En clearingorganisation skall ha ändamålsenliga regler för hur clearingverksamheten hos organisationen skall gå till.

Clearingverksamheten skall drivas under förhållanden som stämmer överens med denna lag och andra författningar och med god sed på värdepappersmarknaden.

Krav på säkerhet m.m.

3 § En clearingorganisation som inträder som part i handeln eller garanterar förpliktelser skall se till att det vid clearingverksamheten ställs betryggande säkerhet för gjorda åtaganden och att sådan säkerhet vidmakthålls så länge åtagandet består. Vid annan clearingverksamhet skall clearingorganisationen se till att det ställs säkerhet för gjorda åtaganden i den utsträckning det behövs.

En säkerhet skall anses betryggande, om det kan antas att åtagandet kan avvecklas utan att ytterligare kapital behöver skjutas till.

70

4 § En clearingorganisation får besluta att efterge kravet på säkerhet, om det är uppenbart att säkerhet inte behövs. Ett sådant beslut får inte tillämpas innan det har godkänts av Finansinspektionen.

5 § Om en clearingorganisation träder in som part i handeln, skall organisationen se till att dess riskmässiga ställning i handeln är balanserad. Uppstår obalans skall organisationen omedelbart vidta åtgärder för att återställa jämvikten.

Tillstånd till förvärv av egendom i vissa fall

6 § En clearingorganisation får bara efter tillstånd av Finansinspektionen förvärva egendom, om företagets motprestation motsvarar mer än 25 procent av dess kapitalbas. Tillstånd skall inhämtas före förvärvet.

Tillstånd skall ges om det inte kan antas att förvärvet leder till överträdelse av denna lag eller andra författningar.

Sidoverksamhet

7 § En clearingorganisation får, utöver clearingverksamhet, i företaget driva bara sådan verksamhet som har nära samband med den.

I syfte att underlätta clearingverksamheten får en clearingorganisation, efter tillstånd av Finansinspektionen, inom kretsen av clearingdeltagare förmedla lån av finansiella instrument och lämna kredit mot säkerhet.

Om det finns särskilda skäl, får Finansinspektionen ge tillstånd till en clearingorganisation att driva även annan verksamhet.

Bemyndigande

8 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om säkerhetskravet enligt 3 och 4 §§.

21 kap. Deltagare i clearingverksamhet

Krav på deltagare i clearingverksamhet

1 § Som deltagare i clearingverksamheten får en clearingorganisation ha Sveriges riksbank och Riksgäldskontoret samt juridiska personer som har en betryggande kapitalstyrka, ändamålsenlig organisation av verksamheten, nödvändiga riskhanteringsrutiner, säkra tekniska system och i övrigt är lämpliga att delta i clearingverksamheten hos clearingorganisationen.

2 § En clearingdeltagare får delta i clearingverksamheten för egen räkning. En clearingorganisation får tillåta svenska och utländska clearingorganisationer eller centrala värdepappersförvarare samt Sveriges riksbank och sådana institut och företag som avses i 14 kap. 3 § första

71

stycket 1 och 2 rätt att delta i clearingverksamheten för någon annans räkning.

Om ett företag inom en koncern deltar i clearingverksamhet uteslutande för egen och för andra koncernföretags räkning skall deltagandet i clearingverksamhet anses vara för egen räkning vid tillämpning av första stycket.

Upplysningsskyldighet och övervakning

3 § En clearingdeltagare skall lämna clearingorganisationen de upplysningar som behövs för att organisationen skall kunna fullgöra sina uppgifter enligt denna lag eller någon annan författning.

4 § Om en clearingdeltagare inte längre uppfyller de krav som anges i 1 §, skall clearingorganisationen besluta att deltagaren inte längre får delta i clearingverksamheten. Detsamma gäller om en clearingdeltagare trots uppmaning från clearingorganisationen inte fullgör sin uppgiftsskyldighet enligt 3 §.

Även om en clearingorganisation enligt första stycket beslutat att en clearingdeltagare inte längre får delta i clearingverksamheten, får deltagaren, om det finns särskilda skäl, ändå vidta åtgärder i förhållande till clearingorganisationen för att skydda uppdragsgivare mot förlust.

5 § En clearingdeltagare som inte står under Finansinspektionens tillsyn eller motsvarande tillsyn i hemlandet är skyldig att på inspektionens begäran lämna uppgifter om förhållanden som rör deltagandet i clearingverksamheten. Inspektionen får förelägga en sådan clearingdeltagare att lämna de begärda uppgifterna.

72

FEMTE AVDELNINGEN

Vissa gemensamma bestämmelser

22 kap. Avbrytande av handel m.m.

Handelsstopp

1 § Avbryter en börs handeln med ett finansiellt instrument på en reglerad marknad (handelsstopp), skall börsen omedelbart underrätta Finansinspektionen om åtgärden, om denna grundas på att

1. investerarna inte har tillgång till information om det finansiella instrumentet på lika villkor,

2. investerarna inte i tillräcklig omfattning har tillgång till information om emittenten,

3. emittentens ställning är sådan att handeln skulle skada investerarnas intressen,

4. det finansiella instrumentet inte uppfyller de krav som följer av den reglerade marknadens regler, eller

5. det annars finns särskilda skäl hänförliga till emittenten eller det finansiella instrumentet.

Handeln med ett visst finansiellt instrument får inte avbrytas av en börs, om det allvarligt skulle skada investerarnas intressen eller hindra marknaden från att fungera korrekt.

2 § Finansinspektionen skall, efter en underrättelse enligt 1 §, så snart det kan ske besluta om handelsstoppet skall bestå. Inspektionen får också, utan föregående beslut av börs, besluta om handelsstopp på sådan grund som anges i 1 §.

Finansinspektionen får besluta att handeln skall avbrytas med ett finansiellt instrument på en handelsplattform eller i annan av ett värdepappersinstitut organiserad handel på sådan grund som anges i 1 §.

Har Finansinspektionen meddelat ett beslut enligt första eller andra stycket, skall börsen eller värdepappersinstitutet besluta när handeln kan återupptas. Ett beslut om att återuppta handeln får, om inte särskilda skäl finns, meddelas först efter samråd med inspektionen. Om ett beslut om att återuppta handeln har meddelats utan ett föregående samråd med inspektionen, skall börsen eller värdepappersinstitutet omedelbart underrätta inspektionen om beslutet.

3 § Om Finansinspektionen har underrättats av en behörig myndighet i ett annat land inom EES om att den myndigheten har begärt att handeln med ett finansiellt instrument på en reglerad marknad skall avbrytas eller meddelat beslut om detta, skall inspektionen besluta att handeln med samma instrument på en reglerad marknad, handelsplattform eller annars genom ett värdepappersinstitut i Sverige, skall stoppas.

Handeln får inte avbrytas enligt första stycket, om det allvarligt skulle skada investerarnas intressen eller hindra marknaden från att fungera korrekt.

73

4 § Ett beslut om handelsstopp får inte gälla längre tid än som är nödvändigt.

5 § Om handeln med ett visst finansiellt instrument har avbrutits enligt 2 § och detta instrument utgör den underliggande tillgången för ett annat finansiellt instrument som är föremål för handel på en reglerad marknad eller en handelsplattform eller annars genom ett värdepappersinstitut, skall börsen respektive värdepappersinstitutet omedelbart avbryta handeln även med det finansiella instrument som inte utgör den underliggande tillgången. Handeln får återupptas först när handeln i det finansiella instrumentet som utgör den underliggande tillgången har återupptagits.

Om det finns särskilda skäl, får Finansinspektionen efter ansökan besluta om undantag från första stycket.

6 § Om handeln med ett visst finansiellt instrument har avbrutits enligt 2 §, skall även annan handel med samma instrument på en reglerad marknad eller handelsplattform avbrytas. Ett värdepappersinstitut får inte heller handla eller medverka vid handel med ett finansiellt instrument som beslutet avser. En tidigare avtalad affär får dock genomföras.

Stängning

7 § Vid krig, krigsfara eller andra onormala förhållanden får regeringen besluta att all handel vid en reglerad marknad skall stängas. I brådskande fall får ett sådant beslut meddelas av börsen efter samråd med Finansinspektionen. Börsens beslut, som får avse högst en vecka, skall omedelbart underställas regeringen.

Offentliggörande av beslut om handelsstopp eller stängning

8 § Beslut enligt detta kapitel om handelsstopp eller stängning skall omedelbart offentliggöras. Om Finansinspektionen har meddelat beslut om handelsstopp enligt 2 § första stycket, skall inspektionen samtidigt underrätta de behöriga myndigheterna i andra länder inom EES.

23 kap. Tillsyn

Tillsynen och dess omfattning

1 § Finansinspektionen har tillsyn över värdepappersinstitut, börser, clearingorganisationer och sådana utländska företag som har tillstånd att driva en reglerad marknad från filial i Sverige.

För svenska värdepappersinstitut, börser och svenska clearingorganisationer omfattar tillsynen att rörelsen drivs enligt denna lag, andra författningar som reglerar företagets verksamhet, företagets bolagsordning, stadgar eller reglemente och interna instruktioner som har sin grund i en författning som reglerar företagets verksamhet.

För ett utländskt företag som driver värdepappersrörelse eller en reglerad marknad eller clearingverksamhet från filial i Sverige omfattar

74

tillsynen att företaget följer de lagar och andra författningar som gäller för företagets verksamhet i Sverige.

Finansinspektionen har därutöver tillsyn över att bestämmelserna om regelbunden finansiell information i 16 kap. följs.

2 § Värdepappersinstitut, börser, clearingorganisationer och sådana utländska företag som har tillstånd att driva en reglerad marknad från filial i Sverige skall lämna Finansinspektionen upplysningar om sin verksamhet och därmed sammanhängande omständigheter enligt föreskrifter som meddelats med stöd av lagen.

Företagen skall, utöver vad som anges i första stycket, lämna Finansinspektionen de upplysningar som inspektionen begär.

3 § För övervakningen av att bestämmelserna i denna lag och genomförandeförordningen samt föreskrifter meddelade med stöd av lagen följs, får Finansinspektionen begära att

1. ett företag eller någon annan tillhandahåller uppgifter, handlingar eller annat, och

2. den som förväntas kunna lämna upplysningar i saken inställer sig till förhör på tid och plats som inspektionen bestämmer.

Första stycket gäller inte i den utsträckning uppgiftslämnandet skulle strida mot den i lag reglerade tystnadsplikten för advokater.

Vid tillämpningen av 16 kap. 1–12 §§ och 17 kap. 1–4 §§ gäller inte första stycket 2.

Finansinspektionen får förelägga den som inte följer en begäran enligt första stycket att göra rättelse.

Platsundersökning

4 § Finansinspektionen får när det är nödvändigt genomföra en undersökning hos

1. ett värdepappersinstitut,

2. en börs,

3. en clearingorganisation,

4. ett sådant utländskt företag som har tillstånd att driva en reglerad marknad från filial i Sverige, samt

5. en emittent som enligt 16 kap. 1–3 §§ omfattas av skyldigheten enligt samma kapitel att upprätta och offentliggöra regelbunden finansiell information.

Finansinspektionen får även genomföra en undersökning hos ett anknutet ombud eller hos ett företag som har fått i uppdrag av ett värdepappersinstitut att utföra visst arbete eller vissa funktioner, om det behövs för tillsynen av institutet.

Samarbete mellan behöriga myndigheter

5 § Finansinspektionen skall i sin tillsynsverksamhet samarbeta och utbyta information med behöriga myndigheter i den utsträckning som följer av direktivet om marknader för finansiella instrument och öppenhetsdirektivet.

75

6 § Finansinspektionen skall inom ramen för sin befogenhet, efter begäran från en behörig myndighet i ett annat land inom EES, lämna eller kontrollera information som behövs för att den utländska myndigheten skall kunna utöva sin tillsyn enligt direktivet om marknader för finansiella instrument. Den utländska myndigheten får närvara vid en kontroll som utförs av Finansinspektionen.

Revision

7 § Finansinspektionen har rätt att förordna en eller flera revisorer att tillsammans med övriga revisorer delta i revisionen av ett svenskt värdepappersinstitut, en börs eller en svensk clearingorganisation. Inspektionen får när som helst återkalla ett sådant förordnande och utse en ny revisor.

Revisorn har rätt till skäligt arvode av företaget för sitt arbete. Storleken på arvodet beslutas av Finansinspektionen.

8 § En revisor skall omedelbart rapportera till Finansinspektionen om han eller hon vid fullgörandet av sitt uppdrag i ett värdepappersbolag får kännedom om förhållanden som

1. kan utgöra en väsentlig överträdelse av någon författning som reglerar bolagets verksamhet,

2. kan påverka bolagets fortsatta drift negativt, eller 3. kan leda till att revisorn avstyrker att balansräkningen eller resultaträkningen fastställs eller till anmärkning enligt 9 kap. 33 eller

34 § aktiebolagslagen (2005:551).

Revisorn har en motsvarande rapporteringsskyldighet om han eller hon får kännedom om förhållanden som avses i första stycket vid fullgörande av uppdrag som revisorn har i värdepappersbolagets moderföretag eller dotterföretag eller ett företag som har en likartad förbindelse med värdepappersbolaget.

9 § Skyldigheten enligt 8 § att rapportera till Finansinspektionen gäller också för särskilda granskare som avses i 10 kap. 21 § aktiebolagslagen (2005:551) i värdepappersbolag.

10 § Vid tillämpningen av 9 kap. 17 § och 10 kap. 10 §aktiebolagslagen (2005:551) om jäv för revisor och lekmannarevisor skall värdepappersbolag anses som aktiebolag som avses i 9 kap. 13 eller 14 § samma lag.

Sammankallande av styrelse eller stämma

11 § Finansinspektionen får sammankalla styrelsen i ett svenskt värdepappersinstitut, en börs eller en svensk clearingorganisation. Inspektionen får även begära att styrelsen kallar till extra stämma. Om styrelsen inte rättar sig efter en sådan begäran, får inspektionen utfärda kallelsen.

76

Företrädare för Finansinspektionen får närvara vid stämma och vid ett sådant styrelsesammanträde som inspektionen har sammankallat samt delta i överläggningarna.

Avgifter till Finansinspektionen m.m.

12 § Värdepappersinstitut, börser, clearingorganisationer samt sådana utländska företag som har tillstånd att driva en reglerad marknad från filial i Sverige skall med årliga avgifter bekosta Finansinspektionens verksamhet.

13 § Finansinspektionens övervakning av regelbunden finansiell information hos en emittent som skall tillämpa bestämmelserna i 16 kap. och vars överlåtbara värdepapper inte är upptagna till handel på en reglerad marknad i Sverige efter ansökan av emittenten, skall bekostas av emittenten genom årliga avgifter till inspektionen.

14 § Om Finansinspektionen behöver anlita någon med särskild fackkunskap för bedömning av en viss fråga vid tillsynen enligt 1 §, skall kostnaden för detta betalas av det företag eller den emittent som tillsynen avser.

Bemyndiganden

15 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om

1. vilka upplysningar ett företag skall lämna till Finansinspektionen enligt 2 § första stycket och när upplysningarna skall lämnas,

2. hur uppgiftsskyldigheten enligt 3 § skall fullgöras, 3. löpande bokföring, årsbokslut och årsredovisning hos börser, clearingorganisationer samt sådana utländska företag som har tillstånd att driva en reglerad marknad från filial i Sverige, samt

4. sådana avgifter för tillsyn som avses i 12 och 13 §§.

24 kap. Särskilt om prövningen av ägares lämplighet

1 § Om ett direkt eller indirekt förvärv av aktier eller andelar i ett värdepappersbolag, en börs eller en svensk clearingorganisation, skulle medföra att förvärvarens sammanlagda innehav utgör ett kvalificerat innehav, krävs tillstånd av Finansinspektionen för förvärvet. Detsamma gäller ett förvärv som innebär att ett kvalificerat innehav ökas

1. så att det uppgår till eller överstiger 20, 33 eller 50 procent av kapitalet eller röstetalet för samtliga aktier eller andelar, eller

2. så att företaget blir dotterföretag. Tillstånd enligt första stycket skall inhämtas före förvärvet. Om förvärvet har gjorts genom bodelning, arv, testamente, bolagsskifte eller på annat liknande sätt, krävs i stället tillstånd för att förvärvaren skall få behålla aktierna eller andelarna. Förvärvaren skall då ansöka om tillstånd inom sex månader efter förvärvet.

77

2 § Frågan om tillstånd får avgöras först efter samråd med behörig myndighet i ett annat land inom EES, om ett förvärv enligt 1 § första stycket skulle innebära att ett värdepappersbolag blev dotterföretag eller kom under kontroll av

1. ett i det landet auktoriserat värdepappersföretag, kreditinstitut, företag för elektroniska pengar eller försäkringsföretag,

2. ett moderföretag till ett sådant företag som avses i 1, eller

3. en fysisk eller juridisk person som kontrollerar ett sådant företag som avses i 1.

3 § Tillstånd skall ges till förvärv som avses i 1 §, om det finns skäl att anta att förvärvaren

1. inte kommer att motverka att rörelsen drivs på ett sätt som är förenligt med denna lag och andra författningar som reglerar företagets verksamhet, och

2. även i övrigt är lämplig att utöva ett väsentligt inflytande över ledningen av ett värdepappersbolag, en börs eller en clearingorganisation.

Tillstånd får inte ges 1. om förvärvaren i väsentlig mån har åsidosatt skyldigheter i näringsverksamhet eller i andra ekonomiska angelägenheter eller gjort sig skyldig till allvarlig brottslighet, eller

2. om, när det är fråga om ett värdepappersbolag, förvärvaren är ett finansiellt holdingföretag eller ett blandat finansiellt holdingföretag och dess ledning inte uppfyller de krav som ställs på ledningen i ett sådant företag enligt 9 kap. 13 § lagen (2006:1371) om kapitaltäckning och stora exponeringar respektive 5 kap. 16 § lagen (2006:531) om särskild tillsyn över finansiella konglomerat.

Om förvärvet av aktier i ett värdepappersbolag skulle leda till nära förbindelser mellan bolaget och någon annan, skall tillstånd ges bara om förbindelserna inte hindrar en effektiv tillsyn av bolaget.

Finansinspektionen får besluta en viss tid inom vilken ett förvärv skall genomföras.

Finansinspektionen skall meddela beslut i ett ärende enligt denna paragraf inom tre månader från det att ansökan om tillstånd gjordes.

4 § Den som avser att avyttra ett kvalificerat innehav eller en så stor del av ett kvalificerat innehav att innehavet därigenom kommer att understiga någon av de i 1 § första stycket angivna gränserna skall underrätta Finansinspektionen om detta.

5 § När ett värdepappersbolag, en börs eller en svensk clearingorganisation får kännedom om att aktier eller andelar i företaget förvärvats enligt 1 § eller avyttrats enligt 4 §, skall företaget snarast anmäla förvärvet eller avyttringen till Finansinspektionen. En börs skall samtidigt offentliggöra förvärvet eller avyttringen.

När ett värdepappersbolag i annat fall får kännedom om att det har nära förbindelser med någon annan, skall bolaget snarast anmäla det till Finansinspektionen.

Ett värdepappersbolag, en börs och en svensk clearingorganisation skall årligen till Finansinspektionen anmäla namnen på de aktie- eller

78

andelsägare som har ett kvalificerat innehav av aktier eller andelar i företaget samt storleken på innehaven. En börs skall samtidigt offentliggöra uppgifterna.

6 § Om en juridisk person har ett kvalificerat innehav i ett värdepappersbolag, en börs eller en svensk clearingorganisation, skall den juridiska personen snarast anmäla ändringar av vilka som ingår i dess ledning till Finansinspektionen.

7 § Finansinspektionen får besluta att ägaren till ett kvalificerat innehav av aktier eller andelar vid stämman inte får företräda fler aktier eller andelar än som motsvarar ett innehav som inte är kvalificerat

1. om ägaren motverkar eller kan antas komma att motverka att företagets rörelse drivs på ett sätt som är förenligt med denna lag eller andra författningar som reglerar företagets verksamhet,

2. om ägaren i väsentlig utsträckning har åsidosatt sina skyldigheter i näringsverksamhet eller i andra ekonomiska angelägenheter eller gjort sig skyldig till allvarlig brottslighet, eller

3. om ägaren, när det är fråga om ett värdepappersbolag, är ett finansiellt holdingföretag eller ett blandat finansiellt holdingföretag och dess ledning inte uppfyller de krav som ställs på ledningen i ett sådant företag enligt 9 kap. 13 § lagen (2006:1371) om kapitaltäckning och stora exponeringar respektive 5 kap. 16 § lagen (2006:531) om särskild tillsyn över finansiella konglomerat.

Om den som har ett kvalificerat innehav av aktier eller andelar inte har ansökt om tillstånd till ett förvärv som avses i 1 §, får Finansinspektionen besluta att innehavaren vid stämman inte får företräda aktierna eller andelarna till den del de omfattas av ett krav på tillstånd.

Om någon i strid med ett beslut av Finansinspektionen har ett kvalificerat innehav av aktier eller andelar, får innehavaren inte företräda aktierna eller andelarna vid stämman till den del innehavet står i strid med beslutet.

8 § Finansinspektionen får förelägga en ägare som avses i 7 § första stycket att avyttra så stor del av aktierna eller andelarna att innehavet därefter inte är kvalificerat. En ägare som avses i 7 § andra eller tredje stycket får föreläggas att avyttra så stor del av aktierna eller andelarna att innehavet inte står i strid med inspektionens beslut.

9 § Aktier eller andelar som omfattas av ett förbud enligt 7 § eller föreläggande enligt 8 § skall inte räknas med när det krävs samtycke av ägare till en viss del av aktierna eller andelarna i företaget för att ett beslut skall bli giltigt eller en befogenhet skall få utövas. Detta gäller dock inte om en förvaltare har förordnats enligt 10 §.

10 § Om det finns särskilda skäl, får Finansinspektionen ansöka om att tingsrätten förordnar en lämplig person att som förvaltare företräda sådana aktier eller andelar som enligt 7 § inte får företrädas av ägaren. En sådan ansökan prövas av tingsrätten i den ort där ägaren har sin hemvist eller, om ägaren inte har hemvist i Sverige, av Stockholms tingsrätt.

79

En förvaltare har rätt till skälig ersättning för arbete och utlägg. Ersättningen skall betalas av ägaren till aktierna eller andelarna och skall på begäran förskotteras av företaget. Om den betalningsskyldige inte godtar förvaltarens anspråk, fastställs ersättningen av tingsrätten.

11 § Om ett värdepappersbolag har nära förbindelser med någon annan och detta hindrar en effektiv tillsyn av värdepappersbolaget, får Finansinspektionen förelägga innehavare av aktier som medför att förbindelserna är nära att avyttra så stor del av aktierna att så inte längre är fallet.

Finansinspektionen får även besluta att den eller de som omfattas av ett föreläggande enligt första stycket inte får företräda aktierna vid stämman. I så fall skall bestämmelserna i 10 § tillämpas.

25 kap. Ingripanden

Ingripande mot svenska värdepappersinstitut, börser och svenska clearingorganisationer

1 § Om ett svenskt värdepappersinstitut, en börs eller en svensk clearingorganisation har åsidosatt sina skyldigheter enligt denna lag, andra författningar som reglerar företagets verksamhet, företagets bolagsordning, stadgar eller reglemente eller interna instruktioner som har sin grund i en författning som reglerar företagets verksamhet, skall Finansinspektionen ingripa.

Finansinspektionen skall då utfärda ett föreläggande att inom viss tid begränsa rörelsen i något avseende, minska riskerna i den eller vidta någon annan åtgärd för att komma till rätta med situationen, ett förbud att verkställa beslut eller en anmärkning. Om överträdelsen är allvarlig, skall företagets tillstånd återkallas eller, om det är tillräckligt, varning meddelas.

2 § Finansinspektionen får avstå från ingripande enligt 1 § om en överträdelse är ringa eller ursäktlig, om företaget gör rättelse eller om något annat organ har vidtagit åtgärder mot företaget som bedöms tillräckliga.

3 § Finansinspektionen får förelägga ett svenskt värdepappersinstitut att upphöra med verksamhet som innefattar handel med finansiella instrument på en marknad, om det med hänsyn till reglerna för eller tillsynen över marknaden framstår som uppenbart olämpligt att institutet bedriver handel där.

4 § Om någon som ingår i ett värdepappersbolags, en börs eller en svensk clearingorganisations styrelse eller är verkställande direktör inte uppfyller de krav som anges i 3 kap. 1 § första stycket 5, 12 kap. 2 § 4 och 19 kap. 3 § 4, skall Finansinspektionen återkalla företagets tillstånd. Detta får dock ske bara om inspektionen först har beslutat att påtala för företaget att personen inte uppfyller kraven, och han eller hon finns kvar

80

i styrelsen eller som verkställande direktör efter det att en av inspektionen bestämd tid om högst tre månader har gått ut.

I stället för att återkalla tillståndet, får Finansinspektionen besluta att en styrelseledamot eller verkställande direktör inte längre får vara det. Inspektionen får då förordna en ersättare. Ersättarens uppdrag gäller till dess företaget har utsett en ny styrelseledamot eller verkställande direktör.

Det som sägs i första och andra styckena om verkställande direktör skall tillämpas även på en ställföreträdare för verkställande direktör.

5 § Finansinspektionen skall återkalla ett svenskt värdepappersinstituts, en börs eller en svensk clearingorganisations tillstånd om

1. företaget har fått tillståndet genom att lämna falska uppgifter eller på något annat otillbörligt sätt,

2. företaget inte inom ett år från det att tillstånd beviljades har börjat driva sådan rörelse som tillståndet avser,

3. företaget har förklarat sig avstå från tillståndet,

4. företaget under en sammanhängande tid av sex månader inte har drivit sådan rörelse som tillståndet avser, eller

5. när det är fråga om svenska aktiebolag som har beviljats tillstånd att driva en reglerad marknad eller clearingverksamhet, bolagets egna kapital understiger två tredjedelar av det registrerade aktiekapitalet och bristen inte har täckts inom tre månader från det att den blev känd för bolaget.

I de fall som avses i första stycket 1, 2, 4 och 5 får i stället varning meddelas om det är tillräckligt.

Vid tillämpningen av första stycket 5 skall det egna kapitalet beräknas enligt 25 kap. 14 § aktiebolagslagen (2005:551).

6 § Om tillståndet återkallas får Finansinspektionen besluta om hur avvecklingen av rörelsen skall ske.

Ett beslut om återkallelse får förenas med förbud att fortsätta rörelsen.

7 § Om en behörig myndighet i ett annat land underrättat Finansinspektionen om att ett värdepappersbolag överträtt föreskrifter som gäller i det landet för bolaget, skall inspektionen vidta de åtgärder som anges i 1, 2 och 4–6 §§ mot bolaget, om det föreligger någon omständighet som avses där. Inspektionen skall underrätta den behöriga myndigheten om vilka åtgärder som vidtas.

Straffavgift

8 § Om ett svenskt värdepappersinstitut, en börs eller en svensk clearingorganisation har meddelats beslut om anmärkning eller varning enligt 1 § eller varning enligt 5 § första stycket 1 och 5 jämfört med andra stycket, får Finansinspektionen besluta att företaget skall betala en straffavgift.

Avgiften tillfaller staten.

9 § Straffavgiften skall uppgå till lägst 5 000 kronor och högst 50 miljoner kronor.

81

Avgiften får inte överstiga tio procent av företagets omsättning närmast föregående räkenskapsår. Om överträdelsen har skett under företagets första verksamhetsår eller om uppgifter om omsättningen annars saknas eller är bristfälliga, får den uppskattas.

För värdepappersinstitut får avgiften inte vara så stor att institutet därefter inte uppfyller kraven i 8 kap. 3 § denna lag eller 6 kap. 1 § lagen (2004:297) om bank- och finansieringsrörelse.

10 § När straffavgiftens storlek beslutas, skall särskild hänsyn tas till hur allvarlig den överträdelse är som har föranlett anmärkningen eller varningen och hur länge överträdelsen har pågått.

Förseningsavgift

11 § Om ett svenskt värdepappersinstitut, en börs eller en svensk clearingorganisation inte lämnar de upplysningar som föreskrivits med stöd av 23 kap. 15 § 1 i tid, får Finansinspektionen besluta att företaget skall betala en förseningsavgift med högst 100 000 kronor.

Avgiften tillfaller staten.

Ingripande mot utländska värdepappersföretag

12 § Finansinspektionen får förelägga ett utländskt värdepappersföretag som hör hemma inom EES och som driver verksamhet från filial i Sverige, att göra rättelse om det överträder någon av följande bestämmelser eller föreskrifter som meddelats med stöd av dem eller överträder bestämmelser i genomförandeförordningen som hänför sig till någon av följande bestämmelser:

– uppföranderegler m.m. i 8 kap. 1, 12 och 22–33 §§, – hantering av limitorder i 9 kap. 1 §, – systematiska internhandlare i 9 kap. 2–8 §§, – information efter handel i 9 kap. 9 §, – dokumentation i 10 kap. 2 §, eller – rapportering av transaktioner i 10 kap. 3 och 4 §§. Om företaget inte följer föreläggandet, skall Finansinspektionen underrätta den behöriga myndigheten i företagets hemland.

Om rättelse inte sker, får Finansinspektionen förbjuda värdepappersföretaget att påbörja nya transaktioner i Sverige. Innan förbud meddelas skall inspektionen underrätta den behöriga myndigheten i företagets hemland. Europeiska gemenskapernas kommission skall omedelbart informeras när ett förbud meddelas.

13 § Om ett utländskt värdepappersföretag som hör hemma inom EES och som driver verksamhet från filial i Sverige, överträder någon annan bestämmelse i genomförandeförordningen, denna lag eller föreskrift som meddelats med stöd av denna lag än dem som anges i 12 §, skall Finansinspektionen underrätta den behöriga myndigheten i företagets hemland. Detsamma gäller om ett företag som genom direkt tillhandahållande av tjänster eller genom att driva en handelsplattform

82

överträder någon bestämmelse i genomförandeförordningen, denna lag eller föreskrift som meddelats med stöd av lagen.

Om värdepappersföretaget efter en sådan underrättelse fortsätter överträdelsen genom att handla på ett sätt som tydligt skadar investerarnas intresse i Sverige eller leder till att marknaden inte fungerar korrekt, får Finansinspektionen förelägga företaget att göra rättelse eller förbjuda företaget att påbörja nya transaktioner i Sverige. Innan föreläggande eller förbud meddelas, skall inspektionen underrätta den behöriga myndigheten i företagets hemland. Europeiska gemenskapernas kommission skall omedelbart informeras när ett föreläggande eller förbud meddelas.

14 § Om ett utländskt värdepappersföretag som hör hemma inom EES och som driver verksamhet i Sverige från filial eller genom direkt tillhandahållande av tjänster, har fått sitt verksamhetstillstånd återkallat i hemlandet, skall Finansinspektionen omedelbart förbjuda företaget att göra nya åtaganden i Sverige.

15 § Om ett utländskt företag som hör hemma utanför EES och som driver värdepappersrörelse från filial i Sverige åsidosätter sina skyldigheter enligt denna lag eller andra författningar som reglerar företagets verksamhet i Sverige, gäller 1 och 2 §§.

Om insättningar hos filialen omfattas av garanti till följd av ett beslut enligt 3 § andra stycket lagen (1995:1571) om insättningsgaranti eller investerarskydd till följd av ett beslut enligt 5 § lagen (1999:158) om investerarskydd och värdepappersföretaget inte fullgör sina skyldigheter enligt de lagarna får Finansinspektionen förelägga värdepappersföretaget att vidta rättelse. Ett sådant föreläggande får bara meddelas om tillstånd till filialetablering inte skulle ha meddelats utan ett beslut enligt lagarna. Ett föreläggande skall innehålla upplysning om att filialtillståndet återkallas om föreläggandet inte följs. Har värdepappersföretaget inte vidtagit rättelse inom ett år från föreläggandet, får inspektionen återkalla tillståndet.

Om filialtillståndet återkallas tillämpas 6 §. Finansinspektionen skall underrätta den behöriga myndigheten i företagets hemland om de åtgärder som har vidtagits med stöd av denna paragraf.

Ingripande mot utländska företag som driver en reglerad marknad eller clearingverksamhet

16 § Om ett utländskt företag som har tillstånd att driva en reglerad marknad eller clearingverksamhet från filial i Sverige har överträtt en bestämmelse i denna lag eller andra författningar som reglerar företagets verksamhet i Sverige, gäller 1 och 2 §§.

Om ett utländskt företag som driver en reglerad marknad i ett annat land inom EES när det vidtar åtgärder i Sverige för att underlätta för deltagare på distans att få tillträde till den reglerade marknaden, överträder denna lag eller en föreskrift som meddelats med stöd av lagen, skall det som sägs i 13 § om utländska värdepappersföretag gälla även för företaget.

83

Ingripande mot den som saknar tillstånd m.m.

17 § Om någon driver sådan verksamhet som omfattas av denna lag utan att vara berättigad till det, skall Finansinspektionen förelägga denne att upphöra med verksamheten. Detsamma gäller om någon i handel med finansiella instrument använder beteckningen börs utan att ha tillstånd att driva en reglerad marknad.

Om det är osäkert om lagen är tillämplig på en viss verksamhet, får inspektionen förelägga den som driver verksamheten att lämna de upplysningar om verksamheten som inspektionen behöver för att bedöma om så är fallet.

Ett föreläggande enligt denna paragraf som avser ett utländskt företag får riktas mot såväl företaget som den som i Sverige är verksam för företagets räkning.

Särskilda bestämmelser om ingripande mot emittenter

Rättelse

18 § Finansinspektionen får förelägga en emittent att göra rättelse om

1. emittenten inte har offentliggjort regelbunden finansiell information enligt 16 kap. 4–7 §§,

2. information som har offentliggjorts är ofullständig eller innehåller väsentliga fel, eller

3. information inte har lämnats till Finansinspektionen enligt 17 kap. 3 §.

Särskild avgift

19 § Finansinspektionen skall besluta att en särskild avgift skall tas ut av en emittent som inte offentliggör regelbunden finansiell information enligt 16 kap. 4–7 §§.

Den särskilda avgiften skall uppgå till lägst 50 000 kronor och högst 10 miljoner kronor.

Avgiften tillfaller staten.

20 § Finansinspektionen får besluta om en särskild avgift bara om den som inspektionen avser att ta ut avgiften av, inom sex månader från det att överträdelsen ägde rum, har delgetts en upplysning om att frågan om särskild avgift har tagits upp av inspektionen.

21 § Om överträdelsen är ringa eller ursäktlig eller om det annars finns särskilda skäl, får en särskild avgift efterges helt eller delvis.

Erinran

22 § Om den regelbundna finansiella informationen som anges i 16 kap. 4–7 §§ inte har upprättats i enlighet med de bestämmelser som gäller för emittenten, skall Finansinspektionen meddela emittenten av de överlåtbara värdepapperen en erinran.

84

En erinran skall inte beslutas om en överträdelse är ringa eller ursäktlig eller om en börs eller en annan reglerad marknad vidtar tillräckliga åtgärder mot emittenten.

Straffavgift

23 § Om en emittent har meddelats beslut om erinran, får Finansinspektionen besluta att emittenten skall betala en straffavgift.

Straffavgiften skall uppgå till lägst 50 000 kronor och högst 10 miljoner kronor.

Avgiften tillfaller staten.

Ingripande mot vissa utländska emittenter av överlåtbara värdepapper

24 § Om Finansinspektionen finner att en emittent som inte har Sverige som hemmedlemsstat men vars överlåtbara värdepapper är upptagna till handel vid en reglerad marknad i Sverige inte uppfyller de krav som följer av bestämmelserna i öppenhetsdirektivet i fråga om behandling av innehavare av värdepapperen och information till sådana innehavare, skall inspektionen underrätta den behöriga myndigheten i den stat inom EES där emittenten enligt tillämplig nationell rätt skall lagra sin regelbundna finansiella information. Detsamma gäller om inspektionen finner att emittenten inte offentliggör information som uppfyller de krav som följer av bestämmelserna i öppenhetsdirektivet, eller inte offentliggör informationen på ett sätt som uppfyller sådana krav.

Om emittenten, trots de åtgärder som har vidtagits av den behöriga myndighet som Finansinspektionen har underrättat, inte följer de bestämmelser i en offentlig reglering som bygger på öppenhetsdirektivet och som har antagits av den stat som avses i första stycket, skall inspektionen offentliggöra det förhållandet att bestämmelserna inte följs. Före offentliggörandet skall Finansinspektionen underrätta den utländska behöriga myndigheten. Finansinspektionen skall också underrätta Europeiska gemenskapernas kommission så snart som möjligt.

Verkställighet av beslut om särskild avgift, straffavgift och förseningsavgift

25 § En särskild avgift, straffavgift eller förseningsavgift skall betalas till Finansinspektionen inom trettio dagar efter det att beslutet om den har vunnit laga kraft eller den längre tid som anges i beslutet.

26 § Finansinspektionens beslut om särskild avgift, straffavgift eller förseningsavgift får verkställas enligt utsökningsbalkens bestämmelser, om avgiften inte har betalats inom den tid som anges i 25 §.

27 § Om den särskilda avgiften, straffavgiften eller förseningsavgiften inte betalas inom den tid som anges i 25 §, skall Finansinspektionen lämna den obetalda avgiften för indrivning. Bestämmelser om indrivning av statliga fordringar finns i lagen (1993:891) om indrivning av statliga fordringar m.m.

85

28 § En särskild avgift, straffavgift eller förseningsavgift som har beslutats faller bort i den utsträckning verkställighet inte har skett inom fem år från det att beslutet vann laga kraft.

Vite

29 § Om Finansinspektionen meddelar föreläggande eller förbud enligt denna lag, får inspektionen förelägga vite.

26 kap. Överklagande

1 § Finansinspektionens beslut enligt 23 kap. 11 § och 25 kap. 17 § andra stycket får inte överklagas.

Andra beslut som Finansinspektionen meddelar enligt denna lag får överklagas hos allmän förvaltningsdomstol. Detta gäller dock inte beslut i ärenden som avses i 20 § första stycket 5 förvaltningslagen (1986:223).

Prövningstillstånd krävs vid överklagande till kammarrätten. Finansinspektionen får bestämma att ett beslut om förbud, föreläggande eller återkallelse skall gälla omedelbart.

2 § Om Finansinspektionen i ett ärende om tillstånd enligt 3 kap. 1 § första stycket eller 12 kap. 2 § inte meddelar beslut inom sex månader från det att ansökan gavs in, skall inspektionen underrätta sökanden om skälen för detta. Sökanden får därefter begära förklaring av kammarrätten att ärendet onödigt uppehålls. Om inspektionen inte har meddelat beslut inom sex månader från det att en sådan förklaring avgetts, skall ansökan anses ha avslagits.

Om Finansinspektionen inte vidarebefordrar en underrättelse som avses i 5 kap. 2 § första stycket till behörig myndighet inom tre månader från det att underrättelsen togs emot och inte heller inom samma tid meddelar beslut enligt tredje stycket samma paragraf, skall inspektionen underrätta sökanden om skälen för detta. Sökanden får därefter begära förklaring av kammarrätten att ärendet onödigt uppehålls. Om underrättelsen inte har vidarebefordrats inom tre månader från det att en sådan förklaring avgetts, skall beslut enligt 5 kap. 2 § tredje stycket anses ha meddelats.

3 § Bolagsverkets beslut att skriva av eller vägra registrering av en ansökan avseende ett anknutet ombud eller beslut att avregistrera ett anknutet ombud enligt 6 kap. 8 eller 9 § får överklagas hos allmän förvaltningsdomstol inom två månader från dagen för beslutet.

Prövningstillstånd krävs vid överklagande till kammarrätten.

4 § Den som är missnöjd med ett beslut av en börs att avslå en ansökan om inregistrering av ett överlåtbart värdepapper enligt 1 kap. 4 § första stycket 2 a eller b får väcka talan mot börsen vid allmän domstol inom tre månader från dagen för beslutet. Detsamma gäller beslut av en börs att avnotera eller avregistrera ett finansiellt instrument. Om talan inte väcks inom denna tid, är rätten till talan förlorad.

86

Ikraftträdande- och övergångsbestämmelser

1. Denna lag träder i kraft den 1 november 2007, då lagen (1991:981) om värdepappersrörelse och lagen (1992:543) om börs- och clearingverksamhet skall upphöra att gälla.

2. Värdepappersinstitut som vid ikraftträdandet av denna lag har tillstånd att driva värdepappersrörelse enligt 1 kap. 3 § lagen (1991:981) om värdepappersrörelse skall anses ha tillstånd enligt denna lag enligt följande: – värdepappersinstitut med tillstånd enligt 1 kap. 3 § första stycket 1 lagen om värdepappersrörelse skall anses ha tillstånd enligt 2 kap. 1 § 2, – värdepappersinstitut med tillstånd enligt 1 kap. 3 § första stycket 2 lagen om värdepappersrörelse skall anses ha tillstånd enligt 2 kap. 1 § 1, – värdepappersinstitut med tillstånd enligt 1 kap. 3 § första stycket 3 lagen om värdepappersrörelse skall anses ha tillstånd enligt 2 kap. 1 § 3, och – värdepappersinstitut med tillstånd enligt 1 kap. 3 § första stycket 4 lagen om värdepappersrörelse skall anses ha tillstånd enligt 2 kap. 1 § 1, 2, 4 och 5.

3. Värdepappersbolag och utländska företag som vid ikraftträdandet av denna lag har tillstånd att driva värdepappersrörelse enligt 1 kap. 3 § första stycket 5 lagen (1991:981) om värdepappersrörelse skall anses ha tillstånd enligt 2 kap. 1 § 6 och 7 samt 2 kap. 2 § första stycket 3 och 6 denna lag. Värdepappersbolag och utländska företag som vid ikraftträdandet har tillstånd till verksamhet som bara avser annan medverkan vid emissioner än garantigivning skall dock anses ha tillstånd enligt 2 kap. 1 § 7 samt 2 kap. 2 § första stycket 3 och 6 denna lag.

4. Kreditinstitut som vid ikraftträdandet av denna lag har tillstånd att driva värdepappersrörelse enligt 1 kap. 3 § första stycket 5 lagen (1991:981) om värdepappersrörelse skall anses ha tillstånd enligt 2 kap. 1 § 6 och 7 denna lag. Kreditinstitut som vid ikraftträdandet har tillstånd till verksamhet som bara avser annan medverkan vid emissioner än garantigivning skall dock anses ha tillstånd enligt 2 kap. 1 § 7 denna lag.

5. Värdepappersbolag och utländska företag som vid ikraftträdandet av denna lag har tillstånd enligt 3 kap. 4 § första stycket 1 lagen (1991:981) om värdepappersrörelse och kreditinstitut med tillstånd enligt 1 kap. 3 § första stycket 1, 2 eller 4 lagen om värdepappersrörelse skall anses ha tillstånd enligt 2 kap. 1 § 5 denna lag.

6. Värdepappersbolag och utländska företag som vid ikraftträdandet av denna lag har tillstånd att driva sidoverksamhet enligt 3 kap. 4 § lagen (1991:981) om värdepappersrörelse skall anses ha tillstånd enligt denna lag enligt följande: – värdepappersbolag och utländska företag med tillstånd enligt 3 kap. 4 § första stycket 2 lagen om värdepappersrörelse skall anses ha tillstånd enligt 2 kap. 2 § första stycket 1, – värdepappersbolag och utländska företag med tillstånd enligt 3 kap. 4 § första stycket 3 lagen om värdepappersrörelse skall anses ha tillstånd enligt 2 kap. 2 § första stycket 1, – värdepappersbolag och utländska företag med tillstånd enligt 3 kap. 4 § första stycket 4 lagen om värdepappersrörelse skall anses ha tillstånd enligt 2 kap. 2 § första stycket 8,

87

– värdepappersbolag och utländska företag med tillstånd enligt 3 kap. 4 § första stycket 5 lagen om värdepappersrörelse skall anses ha tillstånd enligt 2 kap. 2 § första stycket 2,

– värdepappersbolag och utländska företag med tillstånd enligt 3 kap. 4 § första stycket 6 lagen om värdepappersrörelse skall anses ha tillstånd enligt 2 kap. 2 § första stycket 4,

– värdepappersbolag och utländska företag med tillstånd enligt 3 kap. 4 § tredje stycket lagen om värdepappersrörelse skall anses ha tillstånd enligt 2 kap. 3 § andra stycket, och

– värdepappersbolag och utländska företag med tillstånd enligt 3 kap. 4 § fjärde stycket lagen om värdepappersrörelse skall anses ha tillstånd enligt 2 kap. 3 § första stycket.

7. För de värdepappersbolag som avses i 2, 3 och 5 gäller, i stället för 3 kap. 7 § andra stycket första meningen, att kapitalbasen inte får understiga det belopp som anges i 3 kap. 6 § för den aktuella verksamheten. Om detta belopp motsvarar det belopp som bolaget var skyldigt att ha som startkapital enligt 2 kap. 5 § lagen (1991:981) om värdepappersrörelse, skall omräkning av beloppet göras från euro till kronor enligt den valutakurs som gällde vid beslutet om tillstånd enligt lagen om värdepappersrörelse. Om det belopp som anges i 3 kap. 6 § skiljer sig från det belopp som bolaget var skyldigt att ha som startkapital enligt lagen om värdepappersrörelse, skall dock omräkning av beloppet göras från euro till kronor enligt den valutakurs som gäller vid denna lags ikraftträdande.

8. En börs eller auktoriserad marknadsplats som vid ikraftträdandet av denna lag har tillstånd enligt 2 eller 7 kap. lagen (1992:543) om börs- och clearingverksamhet skall anses ha tillstånd att driva en reglerad marknad enligt 12 kap. 1 § denna lag.

9. Om en börs eller auktoriserad marknadsplats vid ikraftträdandet av denna lag redan driver flera marknadsplatser med stöd av sitt tillstånd, skall företaget få tillstånd av Finansinspektionen såsom reglerade marknader för var och en av dessa marknadsplatser, om en anmälan om detta har kommit in till inspektionen före den 1 maj 2008. 10. En clearingorganisation som vid ikraftträdandet av denna lag har tillstånd enligt 8 kap. lagen (1992:543) om börs- och clearingverksamhet skall anses ha tillstånd att driva clearingverksamhet enligt 19 kap. denna lag. 11. Bestämmelserna i 16 kap. 4–7 §§ denna lag skall tillämpas första gången på sådan regelbunden finansiell information som skall offentliggöras närmast efter den 31 oktober 2007. 12. Underrättelser eller ansökningar enligt 1 kap. 3 c § 1 eller 2, eller 1 kap. 4, 5 eller 6 b § lagen (1991:981) om värdepappersrörelse skall ha samma verkan som underrättelser eller ansökningar enligt 4 kap. 1 § 1 eller 2 respektive 5 kap. 1, 4 eller 8 § denna lag, om anmälan om gränsöverskridande har gjorts till den behöriga myndigheten i företagets hemland före ikraftträdandet av denna lag. 13. Om ett värdepappersinstitut har kategoriserat en kund som professionell före ikraftträdandet av denna lag, kan företaget även efter ikraftträdandet behandla kunden som en professionell kund, om

a) kategoriseringen har baserats på en adekvat bedömning av kundens kunskaper och erfarenheter,

88

b) värdepappersinstitutet med stöd av bedömningen försäkrat sig om att kunden kan fatta sina egna investeringsbeslut och är införstådd med därmed förknippade risker, och

c) värdepappersinstitutet har informerat kunden om de kriterier som enligt lagen gäller för kategorisering av kunder.

14. Ett finansiellt instrument som är inregistrerat eller noterat vid en börs eller en auktoriserad marknadsplats enligt 5 kap. 1 §, 6 kap. 1 § eller 7 kap. 2 § lagen (1992:543) om börs- och clearingverksamhet före ikraftträdandet av denna lag skall anses vara upptaget till handel enligt 15 kap. denna lag. 15. En fråga om ingripande enligt 25 kap. bedöms enligt äldre bestämmelser om någon omständighet som föranleder frågan om ingripande hänför sig till tiden före ikraftträdandet av denna lag. Detta gäller dock inte om en tillämpning av de nya bestämmelserna skulle leda till ett mindre strängt ingripande. 16. För beslut som har meddelats enligt lagen (1991:981) om värdepappersrörelse eller lagen (1992:543) om börs- och clearingverksamhet skall bestämmelserna i de lagarna gälla för överklagande och vid handläggningen av överklagandet.

89

2.2 Förslag till lag om ändring i föräldrabalken

Härigenom föreskrivs att 13 kap. 19 § och 14 kap. 21 §föräldrabalken

TPF

1

FPT

skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

13 kap.

19 §

TPF

2

FPT

Om det av någon särskild anledning behövs för att trygga förvaltningen, får överförmyndaren

1. bestämma att 3–7 §§ skall tillämpas även i annat fall än som följer av 2 §,

1. besluta att 3–7 §§ skall tillämpas även i annat fall än som följer av 2 §,

2. begränsa möjligheten att ta ut pengar som har satts in hos bank eller kreditmarknadsföretag, utöver vad som följer av 8 §,

3. bestämma att värdehandlingar skall förvaras och förvaltas av ett värdepappersinstitut enligt lagen (1991:981) om värdepappersrörelse eller ett motsvarande utländskt institut som är underkastat en offentlig reglering som väsentligen stämmer överens med den som gäller för värdepappersinstitut här i landet,

3. besluta att värdehandlingar skall förvaras och förvaltas av ett värdepappersinstitut enligt lagen (2007:000) om värdepappersmarknaden eller ett motsvarande utländskt institut som är underkastat en offentlig reglering som väsentligen stämmer överens med den som gäller för värdepappersinstitut i Sverige,

4. bestämma att premieobligationer som har utfärdats av staten skall skrivas in i statsskuldboken med förbehåll att belopp som hänför sig till obligationerna inte får lyftas utan överförmyndarens samtycke, och

4. besluta att premieobligationer som har utfärdats av staten skall skrivas in i statsskuldboken med förbehåll att belopp som hänför sig till obligationerna inte får lyftas utan överförmyndarens samtycke, och

5. genom meddelande till den som skall betala pengar till den omyndige bestämma att pengarna skall sättas in hos bank eller kreditmarknadsföretag.

5. genom meddelande till den som skall betala pengar till den omyndige besluta att pengarna skall sättas in hos bank eller kreditmarknadsföretag.

Meddelas beslut enligt första stycket 3, skall föräldrarna träffa avtal med värdepappersinstitutet på villkor som överförmyndaren har godkänt. I fråga om rättigheter som registreras enligt lagen (1998:1479) om kontoföring av finansiella instrument får föräldrarna, i stället för att träffa ett avtal om förvaring och förvaltning, på konto i avstämningsregister låta registrera eller, om rättigheten förvaltas av någon som har medgivande som förvaltare enligt den lagen, till denne anmäla att föräldrarna endast med överförmyndarens tillstånd får överlåta eller

TP

1

PT

Balken omtryckt 1995:974.

TP

2

PT

Senaste lydelse 2004:422.

90

pantsätta rättigheten eller uppbära på rättigheten belöpande kapitalbelopp.

Ett värdepappersinstitut är skyldigt att träffa ett sådant avtal om förvaring och förvaltning som avses i andra stycket. Avtalet får inte träffas på sämre villkor än de som värdepappersinstitutet erbjuder andra enskilda personer vid samma typ av avtal.

14 kap.

21 §

TPF

3

FPT

Om det behövs för att trygga förvaltningen, får överförmyndaren

1. begränsa möjligheten att ta ut pengar som har satts in hos bank eller kreditmarknadsföretag, utöver vad som följer av 8 §,

2. bestämma att värdehandlingar skall förvaras och förvaltas av ett värdepappersinstitut enligt lagen (1991:981) om värdepappersrörelse eller ett motsvarande utländskt institut som är underkastat en offentlig reglering som väsentligen stämmer överens med den som gäller för värdepappersinstitut här i landet, och

2. besluta att värdehandlingar skall förvaras och förvaltas av ett värdepappersinstitut enligt lagen (2007:000) om värdepappersmarknaden eller ett motsvarande utländskt institut som är underkastat en offentlig reglering som väsentligen stämmer överens med den som gäller för värdepappersinstitut i Sverige, och

3. genom meddelande till den som skall betala pengar till den enskilde bestämma att pengarna skall sättas in hos bank eller kreditmarknadsföretag.

3. genom meddelande till den som skall betala pengar till den enskilde besluta att pengarna skall sättas in hos bank eller kreditmarknadsföretag.

Meddelas beslut enligt första stycket 2, skall ställföreträdaren träffa avtal med värdepappersinstitutet på villkor som överförmyndaren har godkänt. I fråga om rättigheter som registreras enligt lagen (1998:1479) om kontoföring av finansiella instrument får ställföreträdaren, i stället för att träffa ett avtal om förvaring och förvaltning, på konto i avstämningsregister låta registrera eller, om rättigheten förvaltas av någon som har medgivande som förvaltare enligt den lagen, till denne anmäla att ställföreträdaren endast med överförmyndarens tillstånd får överlåta eller pantsätta rättigheten eller uppbära på rättigheten belöpande kapitalbelopp.

Ett värdepappersinstitut är skyldigt att träffa ett sådant avtal om förvaring och förvaltning som avses i andra stycket. Avtalet får inte träffas på sämre villkor än de som värdepappersinstitutet erbjuder andra enskilda personer vid samma typ av avtal.

U

Denna lag träder i kraft den 1 november 2007.

TP

3

PT

Senaste lydelse 2004:422.

91

2.3 Förslag till lag om ändring i kreditupplysningslagen (1973:1173)

Härigenom föreskrivs att 5 a § kreditupplysningslagen (1973:1173)

TPF

1

FPT

skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

5 a §

TPF

2

FPT

Vad som gäller om tystnadsplikt i svenska kreditinstituts och värdepappersbolags verksamhet hindrar inte att uppgifter om lämnade krediter, betalningsförsummelser och kreditmissbruk utväxlas för kreditupplysningsändamål inom en krets som utgörs av dessa företag samt sådana företag som har tillstånd av Datainspektionen enligt 3 § första stycket.

I den krets som anges i första stycket ingår även utländska kreditinstitut som avses i 4 kap.1, 2, 4 och 6 §§ lagen (2004:297) om bank- och finansieringsrörelse samt utländska företag som avses i 1 kap. 3 c § och 2 kap. 7 § lagen (1991:981) om värdepappersrörelse.

I den krets som anges i första stycket ingår även utländska kreditinstitut som avses i 4 kap.1, 2, 4 och 6 §§ lagen (2004:297) om bank- och finansieringsrörelse samt utländska företag som avses i 4 kap.1 och 4 §§ lagen (2007:000) om värdepappersmarknaden.

Bestämmelser om användningen av uppgifter om betalningsförsummelser och kreditmissbruk finns även i 7 §.

U

Denna lag träder i kraft den 1 november 2007.

TP

1

PT

Lagen omtryckt 1981:737.

TP

2

PT

Senaste lydelse 2004:301.

92

2.4 Förslag till lag om ändring i sekretesslagen (1980:100)

Härigenom föreskrivs att 8 kap. 5 § sekretesslagen (1980:100)

TPF

1

FPT

skall

ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

8 kap.

5 §

TPF

2

FPT

Sekretess gäller i statlig myndighets verksamhet, som består i tillståndsgivning eller tillsyn med avseende på bank- och kreditväsendet, värdepappersmarknaden eller försäkringsväsendet, för uppgift om

1. affärs- eller driftförhållanden hos den som myndighetens verksamhet avser, om det kan antas att han lider skada om uppgiften röjs,

2. ekonomiska eller personliga förhållanden för annan, som har trätt i affärsförbindelse eller liknande förbindelse med den som myndighetens verksamhet avser.

I ärende hos statlig myndighet om innehav av

1. aktier i bankaktiebolag, kreditmarknadsbolag, värdepappersbolag eller försäkringsaktiebolag,

2. andelar i medlemsbank eller kreditmarknadsförening, eller 3. aktier eller andelar i börs, auktoriserad marknadsplats eller clearingorganisation

3. aktier eller andelar i börs eller clearingorganisation

gäller sekretess för uppgift om enskilds personliga eller ekonomiska förhållanden om det kan antas att den enskilde lider skada eller men om uppgiften röjs. Sekretess gäller inte för beslut av myndigheten och inte heller för uppgift som erhållits från annan myndighet om uppgiften inte är sekretessbelagd där.

Sekretess gäller vidare i statlig myndighets verksamhet, som består i övervakning enligt lagen (2006:451) om offentliga uppköpserbjudanden på aktiemarknaden, övervakning enligt lagen (2005:377) om straff för marknadsmissbruk vid handel med finansiella instrument, övervakning enligt lagen (2000:1087) om anmälningsskyldighet för vissa innehav av finansiella instrument, övervakning enligt lagen (1991:980) om handel med finansiella instrument, kontroll enligt lagen (1996:1006) om anmälningsplikt avseende viss finansiell verksamhet eller kontroll enligt lagen (2004:299) om inlåningsverksamhet för sådan uppgift om enskilds ekonomiska eller personliga förhållanden, vilken på begäran har lämnats av någon som är skyldig att lämna uppgifter till myndigheten. Rör uppgiften den uppgiftsskyldige gäller dock sekretess endast om denne kan antas lida skada eller men om uppgiften röjs och sekretess inte motverkar syftet med uppgiftsskyldigheten.

Sekretess gäller, i den mån riksdagen har godkänt avtal härom med främmande stat eller mellanfolklig organisation, hos myndighet i verksamhet som avses i första–tredje styckena för sådan uppgift om affärs- eller driftförhållanden och ekonomiska eller personliga

TP

1

PT

Lagen omtryckt 1992:1474.

TP

2

PT

Senaste lydelse 2006:452.

93

förhållanden som myndigheten erhållit enligt avtalet. Samma sekretess gäller hos Finansinspektionen, i den mån regeringen föreskriver det, om inspektionen från utländsk myndighet eller utländskt organ erhållit uppgifter enligt annat avtal. Föreskrifterna i 14 kap. 1–3 §§ får inte i fråga om denna sekretess tillämpas i strid med avtalet.

Regeringen kan för särskilt fall förordna om undantag från sekretessen enligt första stycket 1, om den finner det vara av vikt att uppgiften lämnas.

Utan hinder av sekretess får uppgift enligt första stycket lämnas till en börs om uppgiften behövs för att börsen skall kunna fullgöra sina uppgifter enligt lagen (1992:543) om börs- och clearingverksamhet eller annan författning.

Utan hinder av sekretess får uppgift enligt första stycket lämnas till en börs eller ett utländskt företag som har tillstånd att driva en reglerad marknad från filial i Sverige om uppgiften behövs för att börsen eller det utländska företaget skall kunna fullgöra sina uppgifter enligt lagen (2007:000) om värdepappersmarknaden eller annan författning.

I fråga om uppgift i allmän handling gäller sekretessen i högst tjugo år.

U

1. Denna lag träder i kraft den 1 november 2007.

2. Äldre bestämmelser gäller fortfarande för uppgifter i ärende hos statlig myndighet om innehav av aktier eller andelar i auktoriserad marknadsplats.

94

2.5 Förslag till lag om ändring i försäkringsrörelselagen (1982:713)

Härigenom föreskrivs i fråga om försäkringsrörelselagen (1982:713)

TPF

1

FPT

dels att 1 kap. 11 §, 2 kap. 5 och 13 a §§, 5 kap. 5 §, 6 a kap. 3, 7 och 18 §§, 7 kap. 10, 10 b och 12 §§, 8 kap. 9 §, 9 kap. 2 a, 5, 9 och 23 §§, 14 kap. 12 § och 14 a kap. 2 § samt att rubriken närmast före 6 a kap. 18 § skall ha följande lydelse,

dels att rubriken närmast före 6 a kap. 21 § skall lyda ”Överlåtelse av egna aktier som inte sker på en reglerad marknad eller en motsvarande marknad utanför EES”.

Nuvarande lydelse Föreslagen lydelse

1 kap.

11 §

TPF

2

FPT

Ett privat försäkringsaktiebolag eller en aktieägare i ett sådant bolag får inte genom annonsering söka sprida aktier eller teckningsrätter i bolaget eller av bolaget utgivna skuldebrev eller optionsbevis.

Ett bolag eller en aktieägare som avses i första stycket får inte heller på annat sätt söka sprida i första stycket angivna värdepapper genom att erbjuda fler än 200 personer att teckna eller förvärva värdepapperen. Detta gäller dock inte om erbjudandet riktar sig enbart till en krets som i förväg har anmält intresse av sådana erbjudanden och antalet utbjudna poster inte överstiger 200.

Begränsningarna i första och andra styckena gäller inte erbjudanden som avser överlåtelse till högst tio förvärvare.

I första stycket angivna värdepapper som har givits ut av ett privat försäkringsaktiebolag får inte bli föremål för handel på börs eller annan organiserad marknadsplats.

Sådana värdepapper som anges i första stycket och som har getts ut av ett privat försäkringsaktiebolag får inte bli föremål för handel på en reglerad marknad eller motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet (EES) eller annan organiserad marknadsplats.

2 kap.

5 §

TPF

3

FPT

Bolagsordningen skall ange för samtliga försäkringsbolag

1. bolagets firma,

2. den ort i Sverige där bolagets styrelse skall ha sitt säte,

3. föremålet för bolagets verksamhet, varvid det särskilt skall anges om verksamheten skall avse såväl direkt försäkring som mottagen återförsäkring,

TP

1

PT

Lagen omtryckt 1995:1567.

TP

2

PT

Senaste lydelse 1999:600.

TP

3

PT

Senaste lydelse 2000:37.

95

4. om bolaget skall driva försäkringsrörelse utanför Europeiska ekonomiska samarbetsområdet (EES),

4. om bolaget skall driva försäkringsrörelse utanför EES,

5. antalet eller lägsta och högsta antalet av de styrelseledamöter, revisorer och eventuella styrelsesuppleanter, som får utses av bolagsstämman, samt tiden för styrelseledamöternas och revisorernas uppdrag,

6. sättet att sammankalla bolagsstämman,

7. vilka ärenden som skall förekomma på den ordinarie stämman,

8. de regler enligt vilka bolagsstämman får förfoga över bolagets vinst eller, i ett livförsäkringsbolag, på annat sätt täcka bolagets förlust, för försäkringsaktiebolag

9. aktiekapitalet eller, om detta utan ändring av bolagsordningen skall kunna bestämmas till lägre eller högre belopp, minimikapitalet och maximikapitalet, varvid minimikapitalet inte får vara mindre än en fjärdedel av maximikapitalet,

10. aktiernas nominella belopp, för ömsesidiga försäkringsbolag

11. den krets av försäkrade som i denna egenskap är delägare, om inte endast försäkringstagarna är delägare,

12. garantikapitalet, 13. regler för hur rösträtten skall utövas och hur beslut skall fattas på bolagsstämman, varvid särskilt skall anges om och i vilken utsträckning delägarnas rösträtt skall utövas genom utsedda delegerade samt i vilken utsträckning rösträtt skall tillkomma garanterna,

14. för vilka försäkringar, i vilka situationer, intill vilket belopp och i vilken ordning uttaxering kan ske hos delägarna i skadeförsäkringsbolag samt hur uttaxeringen skall genomföras,

15. antal och sammanlagt belopp av de försäkringar som skall vara tecknade innan bolaget kan anses bildat,

16. hur tillgångarna skall fördelas mellan delägarna vid bolagets upplösning,

17. i vilken ordning garanterna skall betala in det tecknade garantikapitalet samt

18. om och i vilken ordning vinst skall delas ut till garanterna och i vilken ordning garantikapitalet skall återbetalas.

I fråga om publika försäkringsaktiebolag, vars firma inte innehåller ordet publikt, skall i bolagsordningen anges beteckningen (publ) efter firman.

Om försäkringsbolaget skall ha euro som redovisningsvaluta, skall detta anges i bolagsordningen. Ett försäkringsaktiebolag skall i så fall i bolagsordningen också ange att aktiekapitalet och aktiernas nominella belopp skall vara bestämda i euro.

Vid byte av redovisningsvaluta får ändring av uppgifter som avses i första stycket 9 och 10 anstå till den första ordinarie bolagsstämman efter det att beslutet om byte av redovisningsvaluta fick verkan.

96

13 a §

TPF

4

FPT

Träffar försäkringsaktiebolaget inom två år från registreringen avtal med en stiftare eller en aktieägare som innebär att bolaget förvärvar egendom mot ersättning som motsvarar minst en tiondel av aktiekapitalet, skall styrelsen underställa bolagsstämman avtalet för godkännande. Det gäller dock inte om förvärvet sker på en svensk eller utländsk börs eller på en auktoriserad marknadsplats eller som ett led i bolagets löpande affärsverksamhet.

Träffar försäkringsaktiebolaget inom två år från registreringen avtal med en stiftare eller en aktieägare som innebär att bolaget förvärvar egendom mot ersättning som motsvarar minst en tiondel av aktiekapitalet, skall styrelsen underställa bolagsstämman avtalet för godkännande. Det gäller dock inte om förvärvet sker på en reglerad marknad eller en motsvarande marknad utanför EES eller som ett led i bolagets löpande affärsverksamhet.

Styrelsen skall lämna en redogörelse för de omständigheter som kan vara av vikt vid bedömandet av värdet på egendomen och av avtalet i övrigt. Bestämmelserna i 2 kap. 7 § fjärde och femte styckena tillämpas även på redogörelsen.

En auktoriserad eller godkänd revisor skall avge yttrande över redogörelsen. Yttrandet skall innehålla de uppgifter som avses i 2 kap. 13 § andra stycket 3.

Avtalet skall tillsammans med styrelsens redogörelse och revisorns yttrande hållas tillgängligt för aktieägarna under minst en vecka före den bolagsstämma vid vilken beslutet skall fattas.

5 kap.

5 §

TPF

5

FPT

Beslutet om emission skall ange

1. emissionens belopp eller högsta belopp eller det lägsta och högsta beloppet för emissionen,

2. den företrädesrätt att delta i emissionen som tillkommer aktieägare eller någon annan eller vem som annars får delta i emissionen,

3. den tid inom vilken teckning av skuldebrev kan ske, när ett visst belopp eller ett lägsta belopp har bestämts för emissionen,

4. den tid inom vilken aktieägare kan använda sin företrädesrätt till teckning,

5. skuldebrevens nominella belopp, emissionskursen och räntesatsen,

6. den tid inom vilken tecknade skuldebrev skall betalas samt den beräkningsgrund, enligt vilken vid överteckning de skuldebrev som inte tecknats med företrädesrätt skall fördelas, om det inte föreskrivs att fördelningen skall bestämmas av styrelsen,

7. tiden och villkoren för utbytet eller nyteckningen,

8. den rätt som skall tillkomma borgenären eller innehavaren av optionsbevis för den händelse aktiekapitalet före utbytet eller nyteckningen ökas eller sätts ned eller nya konvertibla skuldebrev eller skuldebrev förenade med optionsrätt till nyteckning ges ut eller bolaget upplöses eller upphör genom fusion,

TP

4

PT

Senaste lydelse 1994:1941.

TP

5

PT

Senaste lydelse 1999:600.

97

9. det belopp som aktiekapitalet skall kunna ökas med genom utbyte eller nyteckning,

10. det aktieslag som de nya aktierna skall höra till, i de fall aktier av olika slag finns eller kan utges, samt

11. den rätt till vinstutdelning som tillkommer de nya aktierna samt det räkenskapsår för vilket rätten till utdelning inträder.

Den tid inom vilken aktieägare kan använda sin företrädesrätt enligt första stycket 4 får inte vara kortare än två veckor.

Tiden räknas från

a) kungörelsen enligt 7 § första stycket första meningen,

b) beslutet, när det gäller sådana fall som avses i 7 § fjärde stycket, eller

c) avstämningsdagen, när det gäller avstämningsbolag. Om ett förbehåll enligt 3 kap. 1 § sjätte stycket eller 3 § eller 6 kap. 8 § skall gälla för de nya aktierna, skall emissionsbeslutet innehålla en upplysning om detta.

Om en aktieägare skall ha företrädesrätt att delta i emissionen, gäller för avstämningsbolag att avstämningsdagen skall anges i emissionsbeslutet. Avstämningsdagen får inte sättas tidigare än tre veckor från kungörelsen enligt 7 § första stycket första meningen.

Om ett skuldebrev skall bli föremål för handel vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad, kan det i emissionsbeslutet tas upp ett bemyndigande för styrelsen eller den som styrelsen inom sig förordnar att innan teckning påbörjas bestämma emissionens belopp, emissionskursen, räntesatsen och villkoren för utbyte eller nyteckning. I fråga om avstämningsbolag skall dock nämnda villkor bestämmas senast på avstämningsdagen, om aktieägarna skall ha företrädesrätt att delta i emissionen.

Om ett skuldebrev skall bli föremål för handel på en reglerad marknad eller en motsvarande marknad utanför EES, kan det i emissionsbeslutet tas upp ett bemyndigande för styrelsen eller den som styrelsen inom sig förordnar att innan teckning påbörjas bestämma emissionens belopp, emissionskursen, räntesatsen och villkoren för utbyte eller nyteckning. I fråga om avstämningsbolag skall dock nämnda villkor bestämmas senast på avstämningsdagen, om aktieägarna skall ha företrädesrätt att delta i emissionen.

6 a kap.

3 §

TPF

6

FPT

Ett publikt skadeförsäkringsaktiebolag och ett publikt livförsäkringsaktiebolag som får dela ut vinst får, om dess aktier är noterade vid en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad, förvärva egna aktier enligt

Ett publikt skadeförsäkringsaktiebolag och ett publikt livförsäkringsaktiebolag som får dela ut vinst får, om dess aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför EES, förvärva egna aktier enligt

TP

6

PT

Senaste lydelse 2000:67.

98

bestämmelserna i 7–9 §§. Beslut om förvärv skall i så fall fattas med tillämpning av 11–16 §§. Om bolaget har förvärvat aktier i strid med 7–9 §§, gäller bestämmelserna i 10 §. Ett bolag som nu sagts får även förvärva egna aktier enligt 4 §.

bestämmelserna i 7–9 §§. Beslut om förvärv skall i så fall fattas med tillämpning av 11–16 §§. Om bolaget har förvärvat aktier i strid med 7–9 §§, gäller bestämmelserna i 10 §. Ett bolag som nu sagts får även förvärva egna aktier enligt 4 §.

Andra publika försäkringsaktiebolag samt privata försäkringsaktiebolag får inte förvärva egna aktier utom i de fall som anges i 4 §. Ett avtal som strider häremot är ogiltigt.

Vad som sägs i första och andra styckena samt 4–16 §§ om förvärv av egna aktier gäller även förvärv som görs av någon annan som handlar i eget namn men för bolagets räkning.

7 §

TPF

7

FPT

Förvärv som avses i 3 § första stycket får ske endast

1. på en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad inom Europeiska ekonomiska samarbetsområdet,

1. på en reglerad marknad,

2. på en börs eller någon annan reglerad marknad utanför Europeiska ekonomiska samarbetsområdet efter tillstånd av Finansinspektionen, eller

2. på en marknad utanför EES som motsvarar en reglerad marknad efter tillstånd av Finansinspektionen, eller

3. i enlighet med ett förvärvserbjudande som har riktats till samtliga aktieägare eller samtliga ägare till aktier av ett visst slag.

Ett tillstånd enligt första stycket 2 skall ange på vilken börs eller marknad förvärvet av egna aktier får ske samt under vilken tid tillståndet får utnyttjas. Tillstånd skall lämnas, om

Ett tillstånd enligt första stycket 2 skall ange på vilken marknad förvärvet av egna aktier får ske samt under vilken tid tillståndet får utnyttjas. Tillstånd skall lämnas, om

1. det för verksamheten vid börsen eller marknaden finns regler som motsvarar vad som enligt lagen (1992:543) om börs- och clearingverksamhet gäller för verksamhet vid en börs eller en auktoriserad marknadsplats i Sverige, och

1. det för verksamheten vid marknaden finns regler som motsvarar de som enligt lagen (2007:000) om värdepappersmarknaden gäller för verksamhet vid en reglerad marknad i Sverige, och

2. börsen eller marknaden står under tillsyn av en myndighet eller något annat behörigt organ.

2. företaget som driver marknaden står under tillsyn av en myndighet eller något annat behörigt organ.

TP

7

PT

Senaste lydelse 2000:67.

99

Överlåtelse av egna aktier på börs eller annan reglerad marknad

Överlåtelse av egna aktier på en reglerad marknad eller en motsvarande marknad utanför EES

18 §

TPF

8

FPT

Ett publikt försäkringsaktiebolag får överlåta egna aktier

1. på en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad inom Europeiska ekonomiska samarbetsområdet, eller

1. på en reglerad marknad, eller

2. på en börs eller någon annan reglerad marknad utanför Europeiska ekonomiska samarbetsområdet efter tillstånd av Finansinspektionen.

2. på en marknad som motsvarar en reglerad marknad utanför EES efter tillstånd av Finansinspektionen.

Ett tillstånd enligt första stycket 2 skall ange på vilken börs eller marknad överlåtelsen av egna aktier får ske samt under vilken tid tillståndet får utnyttjas. Tillstånd skall lämnas, om

Ett tillstånd enligt första stycket 2 skall ange på vilken marknad överlåtelsen av egna aktier får ske samt under vilken tid tillståndet får utnyttjas. Tillstånd skall lämnas, om

1. det för verksamheten vid börsen eller marknaden finns regler som motsvarar vad som enligt lagen (1992:543) om börs- och clearingverksamhet gäller för verksamhet vid en börs eller en auktoriserad marknadsplats i Sverige, och

1. det för verksamheten vid marknaden finns regler som motsvarar de som enligt lagen (2007:000) om värdepappersmarknaden gäller för verksamhet vid en reglerad marknad i Sverige, och

2. börsen eller marknaden står under tillsyn av en myndighet eller ett annat behörigt organ.

2. företaget som driver marknaden står under tillsyn av en myndighet eller ett annat behörigt organ.

7 kap.

10 §

TPF

9

FPT

För skuldtäckning som avses i 9 § får, med de begränsningar som anges i andra–sjätte styckena och 10 a–10 d §§, följande tillgångar användas:

1. Obligationer eller andra skuldförbindelser som svenska staten, en svensk kommun eller därmed jämförlig samfällighet svarar för. 2. Obligationer eller andra skuldförbindelser som Europeiska gemenskaperna eller utländska stater eller centralbanker svarar för.

TP

8

PT

Senaste lydelse 2000:67.

TP

9

PT

Senaste lydelse 2004:430.

100

3. Obligationer eller andra skuldförbindelser som utländsk kommun eller därmed jämförlig utländsk samfällighet med befogenhet att kräva in offentlig uppbörd svarar för. 4. Obligationer eller andra skuldförbindelser som internationella organisationer svarar för.

5. Fordringar på premie eller andra fordringar på försäkringstagare som har samband med försäkringsavtal, om rättssubjekt som anges i 1–4 svarar för fordran. Ett försäkringsbolag som ingår i en koncern och vars verksamhet uteslutande består i att försäkra risker inom koncernen, får för skuldtäckning även använda fordringar som bolag inom koncernen svarar för. Om en fordran enligt denna punkt varit förfallen till betalning längre tid än tre månader, får den dock inte användas för skuldtäckning. 5 a. Fordringar på premier för skadeförsäkring får, när flera premieperioder avtalats och fordringarna avser premier som inte förfallit till betalning för andra perioder än den första, användas för skuldtäckning upp till det belopp som svarar mot avsättningen för försäkringsåtagandet, om avsikten är att åtagandet skall sägas upp vid dröjsmål med betalningen.

6. Skuldförbindelser med säkerhet i bolagets livförsäkringsbrev, inom återköpsvärdet.

7. Medel på konto i bank, kreditmarknadsföretag eller utländskt kreditinstitut.

8. Obligationer och andra skuldförbindelser som ett kreditinstitut eller ett värdepappersbolag med tillstånd enligt 3 kap. 4 § första stycket 4 och 5 lagen (1991:981) om värdepappersrörelse svarar för. Med kreditinstitut avses bank, kreditmarknadsföretag, Svenska skeppshypotekskassan och Sveriges allmänna hypoteksbank.

8. Obligationer och andra skuldförbindelser som ett kreditinstitut eller ett värdepappersbolag med tillstånd enligt 2 kap. 2 § första stycket 2 och 8 lagen (2007:000) om värdepappersmarknaden svarar för. Med kreditinstitut avses bank, kreditmarknadsföretag, Svenska skeppshypotekskassan och Sveriges allmänna hypoteksbank.

9. Obligationer och andra skuldförbindelser som ett utländskt kreditinstitut svarar för. 10. Obligationer och andra skuldförbindelser som ett publikt aktiebolag eller ett motsvarande utländskt bolag svarar för. 11. Aktier och andra värdepapper som kan jämställas med aktier, som har getts ut av ett publikt aktiebolag, ett publikt försäkringsaktiebolag eller ett motsvarande utländskt bolag, med undantag av bolag som avses i 12. 12. Aktier och andra värdepapper som kan jämställas med aktier, som har getts ut av ett publikt aktiebolag eller ett motsvarande utländskt bolag, under förutsättning att bolaget har till uppgift att äga sådana tillgångar som anges i 13. 13. Fastigheter, tomträtter och byggnader samt andelar i sådan egendom. 14. Skuldförbindelser som fysiska personer och andra subjekt än de som anges i 1–4 och 8–10 svarar för och som panträtt i

14. Skuldförbindelser som fysiska personer och andra subjekt än de som anges i 1–4 och 8–10 svarar för och som panträtt i

101

fastighet eller tomträtt lämnats som säkerhet för. Panträtten skall ligga inom en viss andel av fastighetens eller tomträttens värde. Regeringen eller den myndighet som regeringen bestämmer skall meddela föreskrifter om andelens storlek och om värdering av fastigheter och tomträtter för tillämpningen av bestämmelserna i denna punkt.

fastighet eller tomträtt lämnats som säkerhet för. Panträtten skall ligga inom en viss andel av fastighetens eller tomträttens värde. Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om andelens storlek och om värdering av fastigheter och tomträtter för tillämpningen av bestämmelserna i denna punkt.

15. Skuldförbindelser som fysiska personer och andra subjekt än de som anges i 1–4 och 8–10 svarar för och som annan betryggande säkerhet än panträtt i fastighet eller tomträtt lämnats som säkerhet för. 16. Kassa. 17. Andelar i investeringsfonder och i sådana fondföretag som avses i 1 kap. 7 § lagen (2004:46) om investeringsfonder, om de förvaltade tillgångarna huvudsakligen består av tillgångar som får användas för skuldtäckning. Vid tillämpningen av denna punkt krävs inte en sådan anmälan från fondförvaltaren som avses i nämnda paragraf. 18. Beslutad överskjutande skatt. 19. Återförsäkringsgivares fordran hos det avgivande försäkringsbolaget (återförsäkringstagaren) som grundas på att återförsäkringstagaren har hållit kvar tillgångar som motsvarar en avgiven återförsäkring. Andra fondpapper än som avses i 10 a § första stycket 1, får endast användas för skuldtäckning om de är kortfristigt realiserbara eller är föremål för handel på en reglerad marknad som är öppen för allmänheten.

Andra fondpapper än sådana som avses i 10 a § första stycket 1, får bara användas för skuldtäckning om de är kortfristigt realiserbara eller är föremål för handel på en reglerad marknad eller en motsvarande marknad utanför EES.

Aktier och andra värdepapper som kan jämställas med aktier, som har getts ut av ett privat aktiebolag får användas för skuldtäckning under förutsättning att bolaget är ett dotterbolag som anges i 10 a § första stycket 1.

Utländska tillgångar som avses i första stycket 2–4, 7 och 9–12 får användas för skuldtäckning i den mån det följer av föreskrifter som meddelats av regeringen eller den myndighet som regeringen bestämt

1. såvitt angår första stycket 2, om vilka utländska stater och utländska centralbanker som avses,

2. såvitt angår första stycket 4, om vilka internationella organisationer som avses, samt

3. såvitt angår första stycket 3, 7 och 9–12, om vilka stater de rättssubjekt som avses skall vara belägna eller ha sitt säte i.

Tillgångar får användas för skuldtäckning endast till den del de inte belastas av panträtt eller annan säkerhetsrätt.

För att tillgångar enligt första stycket 13 skall få användas för skuldtäckning skall byggnader som hör till fastigheter och tomträtter vara brandförsäkrade. Detsamma gäller byggnader som hör till fastigheter och

102

tomträtter som utgör säkerhet för skuldförbindelser enligt första stycket 14.

Förlagsbevis och förlagsandelsbevis skall vid tillämpningen av bestämmelserna i 10 b och 10 c §§ jämställas med tillgångar som anges i första stycket 11 och 12.

Finansinspektionen får, om det finns särskilda skäl, medge att även andra slag av tillgångar än som anges i första stycket tillfälligt får användas för skuldtäckning.

10 b §

TPF

10

FPT

Av det belopp som skall skuldtäckas får en andel om högst – 75 procent motsvaras av tillgångar som anges i 10 § första stycket 7– 10, varav högst 50 procentenheter får motsvaras av tillgångar som anges i 10 § första stycket 10,

– 25 procent motsvaras av tillgångar som anges i 10 § första stycket 11,

– 25 procent motsvaras av tillgångar som anges i 10 § första stycket 12–14,

– 10 procent motsvaras av tillgångar som anges i 10 § första stycket 15 och

– 3 procent motsvaras av tillgångar som anges i 10 § första stycket 16. Andra fondpapper än som avses i 10 § första stycket 17 och 10 a § första stycket 1, och som inte omsätts på någon reglerad marknad som är öppen för allmänheten, får uppgå till högst 10 procent av de tillgångar som används för skuldtäckning.

Andra fondpapper än sådana som avses i 10 § första stycket 17 och 10 a § första stycket 1, och som inte omsätts på någon reglerad marknad eller en motsvarande marknad utanför EES, får uppgå till högst 10 procent av de tillgångar som används för skuldtäckning.

Vid tillämpningen av bestämmelserna i första stycket skall även beaktas ett försäkringsbolags indirekta ägande av tillgångar genom dess innehav av andelar i investeringsfonder eller placeringar i fondföretag som används för skuldtäckning.

Finansinspektionen får, om det finns särskilda skäl, medge tillfälliga avvikelser från de begränsningar som anges i första och andra styckena. Om det finns synnerliga skäl får Finansinspektionen också medge avvikelser, som inte är tillfälliga, från begränsningarna i första stycket första–fjärde strecksatserna.

Sådana avvikelser som anges i fjärde stycket får även medges om

1. det på grund av ändrade antaganden om ränta krävs en väsentlig ökning av livförsäkringsavsättningarna,

2. en anpassning till begränsningarna i första och andra styckena skulle medföra väsentliga men för kapitalförvaltningen, och

3. bolaget har särskilda förutsättningar för att tillgodose kraven i 9 a § andra och tredje meningarna.

TP

10

PT

Senaste lydelse 2004:53.

103

12 §

TPF

11

FPT

Bestämmelserna i 10 och 10 b §§ gäller inte för tillgångar som svarar mot försäkringstekniska avsättningar i verksamhet avseende tjänstepensionsförsäkring. För sådana tillgångar gäller, utöver de begränsningar som följer av 9 a, 10 a och 10 c–10 e §§ samt av andra stycket i denna paragraf, att de skall placeras på det sätt som bäst gagnar de ersättningsberättigades intressen och också i övrigt på ett aktsamt sätt.

Av det belopp som skall skuldtäckas i verksamhet avseende tjänstepensionsförsäkring får en andel om högst

1. tio procent utgöras av aktier och andra värdepapper som kan jämställas med aktier samt obligationer och andra skuldförbindelser, om värdepapperen eller skuldförbindelserna inte är föremål för handel på reglerade marknader,

1. tio procent utgöras av aktier och andra värdepapper som kan jämställas med aktier samt obligationer och andra skuldförbindelser, om värdepapperen eller skuldförbindelserna inte är föremål för handel på reglerade marknader eller motsvarande marknader utanför EES,

2. tre procent utgöras av kontanta medel,

3. fem procent utgöras av aktier och andra värdepapper som kan jämställas med aktier samt obligationer och andra skuldförbindelser från samma emittent eller låntagare, om denne i egenskap av arbetsgivare betalar försäkringspremier till försäkringsbolaget (uppdragsgivande företag), och

4. tio procent utgöras av sådana tillgångar som avses i 3 och som getts ut av företag i en grupp av emittenter eller låntagare med sådan inbördes anknytning som anges i 10 c § andra stycket, vari ett uppdragsgivande företag ingår.

Begränsningarna i andra stycket 3 och 4 gäller inte sådana tillgångar som svenska staten eller en utländsk stat svarar för.

Om det finns särskilda skäl får Finansinspektionen i enskilda fall besluta om undantag från de begränsningar som anges i andra stycket 1 och 2.

8 kap.

9 §

TPF

12

FPT

I ett försäkringsaktiebolag, vars aktier är noterade vid en börs eller en auktoriserad marknadsplats, skall styrelsen varje år upprätta förslag till riktlinjer för bestämmande av lön och annan ersättning till den verkställande direktören och andra personer i bolagets ledning. Med ersättning jämställs överlåtelse av värdepapper och upplåtelse av rätt att i framtiden förvärva värdepapper från bolaget.

I ett försäkringsaktiebolag, vars aktier är upptagna till handel på en reglerad marknad i Sverige, skall styrelsen varje år upprätta förslag till riktlinjer för bestämmande av lön och annan ersättning till den verkställande direktören och andra personer i bolagets ledning. Med ersättning jämställs överlåtelse av värdepapper och upplåtelse av rätt att i framtiden förvärva värdepapper från bolaget.

TP

11

PT

Senaste lydelse 2005:1121.

TP

12

PT

Senaste lydelse 2006:563.

104

Riktlinjerna skall avse tiden från nästa ordinarie bolagsstämma.

Riktlinjerna skall avse tiden från nästa ordinarie bolagsstämma.

Information om tidigare beslutade ersättningar som inte har förfallit till betalning skall fogas till förslaget.

Om, i fall som avses i 9 b §, de riktlinjer som bolagsstämman har beslutat om inte har följts, skall även information om detta och om skälet till avvikelsen fogas till förslaget.

Första stycket gäller inte sådana emissioner och överlåtelser som omfattas av lagen (1987:464) om vissa riktade emissioner i aktiemarknadsbolag, m.m. Det gäller inte heller ersättning som omfattas av 1 a § första stycket.

Lydelse enligt prop. 2006/07:65 Föreslagen lydelse

9 kap.

2 a §

Ett publikt försäkringsaktiebolag vars aktier är noterade vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad, skall inför en bolagsstämma tillhandahålla aktieägarna ett fullmaktsformulär.

Ett publikt försäkringsaktiebolag vars aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför EES, skall inför en bolagsstämma tillhandahålla aktieägarna ett fullmaktsformulär.

Formuläret skall tillhandahållas tillsammans med kallelsen till bolagsstämman, om kallelsen sänds till aktieägarna. Om kallelse sker på något annat sätt, skall fullmaktsformuläret tillhandahållas aktieägarna på begäran efter det att bolagsstämman har tillkännagetts.

Formuläret får inte innehålla namn på ombud eller ange hur ombudet skall rösta.

Nuvarande lydelse Föreslagen lydelse

5 §

TPF

13

FPT

Ordinarie bolagsstämma skall hållas inom sex månader efter utgången av varje räkenskapsår. Vid den ordinarie bolagsstämman skall årsredovisningen och revisionsberättelsen samt, i moderbolag, koncernredovisningen och koncernrevisionsberättelsen läggas fram.

Vid stämman skall beslut fattas

1. om fastställelse av resultaträkningen och balansräkningen samt, i moderbolag, koncernresultaträkningen och koncernbalansräkningen,

2. om dispositioner beträffande bolagets vinst eller förlust enligt den fastställda balansräkningen,

3. om ansvarsfrihet för styrelseledamöterna och verkställande direktören,

4. i andra ärenden som ankommer på stämman enligt denna lag eller bolagsordningen.

Vid den ordinarie bolagsstämman i ett försäkringsaktie-

Vid den ordinarie bolagsstämman i ett försäkringsaktie-

TP

13

PT

Senaste lydelse 2006:563.

105

bolag, vars aktier är noterade vid en börs eller en auktoriserad marknadsplats, skall beslut även fattas om riktlinjer för ersättning till ledande befattningshavare. Riktlinjerna skall ha det innehåll som anges i 8 kap. 9 § första stycket och 9 a § första stycket.

bolag, vars aktier är upptagna till handel på en reglerad marknad i Sverige, skall beslut även fattas om riktlinjer för ersättning till ledande befattningshavare. Riktlinjerna skall ha det innehåll som anges i 8 kap. 9 § första stycket och 9 a § första stycket.

Beslut i frågor som avses i andra stycket 1–3 skall dock anstå till en fortsatt stämma, om i försäkringsaktiebolag majoriteten eller en minoritet bestående av ägare till en tiondel av samtliga aktier begär det. Detsamma gäller i ömsesidiga försäkringsbolag om en tiondel av de närvarande röstberättigade begär det. En sådan stämma skall hållas minst en och högst två månader därefter. Något ytterligare uppskov är inte tillåtet.

Lydelse enligt prop. 2006/07:65 Föreslagen lydelse

9 §

Kallelse till bolagsstämma skall utfärdas tidigast fyra veckor före stämman. Om inte bolagsordningen anger längre tid, skall kallelsen utfärdas senast två veckor före stämman. Uppskjuts stämman till en dag som infaller senare än fyra veckor efter det att stämman har inletts, skall kallelse ske till den fortsatta stämman. Fordras enligt bolagsordningen för giltighet av ett bolagsstämmobeslut att det fattas på två stämmor, kan kallelse till den andra stämman inte ske innan den första stämman har hållits. I sådan kallelse skall det anges vilket beslut den första stämman har fattat.

Kallelse skall ske enligt bolagsordningen. En skriftlig kallelse skall dock alltid sändas till varje aktieägare eller röstberättigad i ett ömsesidigt försäkringsbolag vars postadress är känd för bolaget, om

1. den ordinarie bolagsstämman skall hållas på någon annan tid än den som anges i bolagsordningen, eller

2. bolagsstämman skall behandla frågor om

a) sådana ändringar av bolagsordningen som avses i 16 och 18 §§,

b) bolagets försättande i likvidation eller

c) upphörande av bolagets likvidation. Kallelsen skall innehålla uppgift om tid och plats för bolagsstämman samt uppgift om förutsättningarna för att få delta i stämman. I kallelsen skall det också tydligt anges vilka ärenden som skall behandlas på stämman. Om ett ärende avser en ändring av bolagsordningen, skall det huvudsakliga innehållet i förslaget till ändringen anges i kallelsen. Att i vissa fall särskilda uppgifter skall anges i kallelsen följer av 4 kap. 7 § andra stycket och 1 § tredje stycket detta kapitel.

I ett publikt försäkringsaktiebolag vars aktier är noterade vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad, skall en kallelse till en bolagsstämma även innehålla uppgift om det totala antalet aktier och röster i

I ett publikt försäkringsaktiebolag vars aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför EES, skall en kallelse till en bolagsstämma även innehålla uppgift om det totala antalet aktier och röster i bolaget. Uppgifterna

106

bolaget. Uppgifterna skall avse förhållandena vid tidpunkten för bolagsstämman eller, i fråga om avstämningsbolag, tio dagar före bolagsstämman. Om detta inte är möjligt, skall uppgifterna avse förhållandena vid den tidpunkt då kallelsen utfärdades.

skall avse förhållandena vid tidpunkten för bolagsstämman eller, i fråga om avstämningsbolag, tio dagar före bolagsstämman. Om detta inte är möjligt, skall uppgifterna avse förhållandena vid den tidpunkt då kallelsen utfärdades.

Under minst en vecka närmast före den stämma, som avses i 5 §, skall redovisningshandlingarna, revisionsberättelsen och revisorns yttrande enligt 8 kap. 9 c § eller avskrifter av dessa hållas tillgängliga hos bolaget för aktieägarna och de röstberättigade samt genast sändas till de aktieägare eller de röstberättigade som begär det och uppger sin postadress.

23 §

Under de förutsättningar som anges i 24–26 §§ får ett publikt försäkringsaktiebolag vars aktier är noterade vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad, lämna information till aktieägare med elektroniska hjälpmedel även när det i lagen anges att informationen skall lämnas på något annat sätt.

Under de förutsättningar som anges i 24–26 §§ får ett publikt försäkringsaktiebolag, vars aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför EES, lämna information till aktieägare med elektroniska hjälpmedel även när det i lagen anges att informationen skall lämnas på något annat sätt.

Nuvarande lydelse Föreslagen lydelse

14 kap.

12 §

TPF

14

FPT

Likvidatorerna skall så snart det kan ske genom försäljning på offentlig auktion eller på något annat lämpligt sätt förvandla bolagets egendom till pengar, i den mån det behövs för likvidationen, samt betala bolagets skulder. Bolagets rörelse får fortsättas, om det behövs för en ändamålsenlig avveckling eller för att de anställda skall få ett skäligt rådrum för att skaffa sig nya anställningar.

Har Finansinspektionen förordnat en likvidator och vägrar denne utan skäl samtycke till avyttring under hand av bolagets egendom får inspektionen på ansökan av övriga likvidatorer tillåta försäljningen. Om likvidatorerna önskar överlåta finansiella instrument som är noterade vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller

Har Finansinspektionen förordnat en likvidator och vägrar denne utan skäl samtycke till avyttring under hand av bolagets egendom får inspektionen på ansökan av övriga likvidatorer tillåta försäljningen. Om likvidatorerna önskar överlåta finansiella instrument som är upptagna till handel på en reglerad marknad eller en motsvarande marknad

TP

14

PT

Senaste lydelse 1992:549.

107

någon annan reglerad marknad till gällande börs- eller marknadspris behövs inte något samtycke.

utanför EES till gällande marknadspris behövs inte något samtycke.

14 a kap.

2 §

TPF

15

FPT

Om frågan om lösenbeloppet för en aktie som skall lösas in enligt detta kapitel är tvistig, skall lösenbeloppet bestämmas med tillämpning av andra–fjärde styckena.

Lösenbeloppet för en aktie skall bestämmas så att det motsvarar det pris för aktien som kan påräknas vid en försäljning under normala förhållanden. För en aktie som är föremål för handel vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad skall lösenbeloppet motsvara det noterade värdet, om inte särskilda skäl motiverar något annat.

Lösenbeloppet för en aktie skall bestämmas så att det motsvarar det pris för aktien som kan påräknas vid en försäljning under normala förhållanden. För en aktie som är föremål för handel på en reglerad marknad eller en motsvarande marknad utanför EES skall lösenbeloppet motsvara det noterade värdet, om inte särskilda skäl motiverar något annat.

Lösenbeloppet skall bestämmas med hänsyn till förhållandena vid den tidpunkt då begäran om prövning av skiljemän enligt 5 § gjordes. Om det finns skäl för det, får beloppet i stället bestämmas med hänsyn till förhållandena vid en tidpunkt som infaller tidigare.

Har ett yrkande om inlösen av aktie enligt detta kapitel föregåtts av ett offentligt erbjudande att förvärva samtliga aktier som budgivaren inte redan innehar och har detta erbjudande antagits av ägare till mer än nio tiondelar av de aktier som erbjudandet avser, skall lösenbeloppet motsvara det erbjudna vederlaget, om inte särskilda skäl motiverar något annat.

U

Denna lag träder i kraft den 1 november 2007.

TP

15

PT

Senaste lydelse 2006:427.

108

2.6 Förslag till lag om ändring i konkurslagen (1987:672)

Härigenom föreskrivs att 8 kap. 7 § konkurslagen (1987:672) skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

8 kap.

7 §

TPF

1

FPT

Försäljning av lös egendom som inte sker genom fortsättande av gäldenärens rörelse skall ske på auktion eller på annat sätt efter vad förvaltaren anser vara mest fördelaktigt för boet. Om egendom säljs till konkursgäldenären eller någon denne sådan närstående person som anges i 4 kap. 3 § skall försäljningen ha föregåtts av ett offentligt anbudsförfarande, om särskilda skäl inte gör det obehövligt.

Lös egendom i vilken en borgenär har panträtt eller någon annan särskild förmånsrätt får inte utan hans samtycke säljas på annat sätt än på auktion, om hans rätt är beroende av försäljningen. Även om samtycke inte lämnas, får egendomen säljas på annat sätt än på auktion, om det är sannolikt att högre pris uppnås därigenom och om tillsynsmyndigheten medger det.

Samtycke enligt andra stycket krävs inte när förvaltaren säljer finansiella instrument, noterade vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad, eller valuta till gällande börs- eller marknadspris eller när det är fråga om försäljning av lös egendom genom fortsättande av gäldenärens rörelse.

Samtycke enligt andra stycket krävs inte när förvaltaren säljer finansiella instrument, upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet, eller valuta till gällande marknadspris eller när det är fråga om försäljning av lös egendom genom fortsättande av gäldenärens rörelse.

Särskilda bestämmelser om överlåtelse av försäkringsbestånd finns i 14 kap.26 och 27 §§försäkringsrörelselagen (1982:713).

U

Denna lag träder i kraft den 1 november 2007.

TP

1

PT

Senaste lydelse 1999:1310.

109

2.7 Förslag till lag om ändring i lagen (1990:661) om avkastningsskatt på pensionsmedel

Härigenom föreskrivs att 7 § lagen (1990:661) om avkastningsskatt på pensionsmedel skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

7 §

TPF

1

FPT

Värdepapper, som är noterat vid en svensk eller utländsk börs eller noterat vid en auktoriserad marknadsplats eller som annars är föremål för regelbunden handel vid någon annan reglerad marknad som är öppen för allmänheten, tas upp till det noterade värdet.

Värdepapper, som är upptaget till handel på en reglerad marknad, en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet eller som annars är föremål för regelbunden handel vid någon annan marknad som är reglerad och öppen för allmänheten, tas upp till det noterade värdet.

Finns i ett bolag skilda aktieslag av vilka ett eller flera är börsnoterade eller föremål för sådan notering som avses i första stycket, skall de aktier i bolaget som inte är noterade tas upp till samma värde som de noterade aktierna. Är flera aktieslag noterade, skall de inte noterade aktierna tas upp till samma värde som de noterade aktier som har den lägsta kursen.

Finns det i ett bolag skilda aktieslag av vilka ett eller flera är upptagna till handel på en reglerad marknad eller föremål för sådan handel som avses i första stycket, skall de aktier i bolaget som inte är upptagna till eller föremål för handel tas upp till samma värde som de aktier som är upptagna till eller föremål för handel. Är flera aktieslag upptagna till eller föremål för handel, skall de aktier som inte är upptagna till eller föremål för handel tas upp till samma värde som de aktier som är upptagna till eller föremål för handel som har den lägsta kursen.

Om det vid värdering enligt de föregående styckena finns synnerliga skäl anta att det noterade värdet inte motsvarar vad som skulle kunna påräknas vid en försäljning under normala förhållanden, får i stället det beräknade priset vid en sådan försäljning läggas till grund för värderingen.

Aktie eller andel i dotterbolag, som direkt eller indirekt har till ändamål att äga fastigheter (fastighetsbolag) skall värderas med ledning av marknadsvärdena på fastigheterna.

TP

1

PT

Senaste lydelse 1994:1878.

110

U

1. Denna lag träder i kraft den 1 november 2007.

2. Äldre bestämmelser gäller alltjämt vid fastställande av kapitalunderlag som avser tid före ikraftträdandet.

111

2.8 Förslag till lag om ändring i lagen (1991:980) om handel med finansiella instrument

Härigenom föreskrivs att 1 kap. 1 §, 2 kap.17, 911, 13, 14, 1619, 2124, 26, 2830, 3235 och 3739 §§, 2 a kap.3, 6 och 10 §§, 2 b kap. 3 §, 4 kap.1, 14, 17, 19, 21 och 22 §§, 6 kap.1 a1 g §§ samt 7 kap. 1 § lagen (1991:980) om handel med finansiella instrument

TPF

1

FPT

skall ha följande

lydelse.

Lydelse enligt prop. 2006/07:65 Föreslagen lydelse

1 kap.

1 §

I denna lag betyder

U

finansiellt instrument

U

: fond-

papper och annan rättighet eller förpliktelse avsedd för handel på värdepappersmarknaden,

U

finansiellt instrument:

U

det som

anges i 1 kap. 4 § första stycket 1 lagen (2007:000) om värdepappersmarknaden,

fondpapper: aktie och obligation samt sådana andra delägarrätter eller fordringsrätter som är utgivna för allmän omsättning, fondandel och aktieägares rätt gentemot den som för hans räkning förvarar aktiebrev i ett utländskt bolag (depåbevis),

U

överlåtbart värdepapper

U

: det

som anges i 1 kap. 4 § första stycket 2 lagen om värdepappersmarknaden,

U

penningmarknadsinstrument

U

:

det som anges i 1 kap. 4 § första stycket 3 lagen om värdepappersmarknaden,

U

börs:

U

det som anges i 1 kap.

5 § 3 lagen om värdepappersmarknaden och sådant utländskt företag som har tillstånd att driva en reglerad marknad från filial i Sverige,

U

reglerad marknad:

U

det som

anges i 1 kap. 5 § 20 lagen om värdepappersmarknaden,

EES: Europeiska ekonomiska samarbetsområdet,

U

anmält avvecklingssystem

U

: vad

som anges i 2 § lagen (1999:1309) om system för avveckling av förpliktelser på finansmarknaden,

U

anmält avvecklingssystem

U

: det

som anges i 2 § lagen (1999:1309) om system för avveckling av förpliktelser på finansmarknaden,

prospektdirektivet: Europaparlamentets och rådets direktiv 2003/71/EG av den 4 november 2003 om de prospekt som skall offentliggöras när

TP

1

PT

Lagen omtryckt 1992:558.

112

värdepapper erbjuds till allmänheten eller tas upp till handel och om ändring av direktiv 2001/34/EG

TPF

2

FPT

,

prospektförordningen: kommissionens förordning (EG) nr 809/2004 av den 29 april 2004 om genomförande av Europaparlamentets och rådets direktiv 2003/71/EG i fråga om informationen i prospekt, utformningen av dessa, införlivande genom hänvisning samt offentliggörande av prospekt och spridning av annonser

TPF

3

FPT

,

emittent: i fråga om aktier aktiebolaget och i fråga om annat finansiellt instrument utgivaren eller utfärdaren av instrumentet,

U

aktierelaterat

U

finansiellt instru-

ment:

1. aktie och finansiellt instrument som kan jämställas med aktie, såsom interimsbevis, fondaktierätt och teckningsrätt, samt

2. finansiellt instrument, såsom konvertibel där rätten att begära konvertering tillkommer emittenten och teckningsoption, som ger rätt att förvärva sådant instrument som avses i 1 genom konvertering eller utövande av annan rättighet som instrumentet är bärare av, om instrumentet utfärdats av emittenten av den aktie som rättigheten hänför sig till eller av ett bolag som ingår i samma koncern som den emittenten,

U

aktierelaterat överlåtbart värdepapper

U

:

1. aktie och överlåtbart värdepapper som kan jämställas med aktie, såsom interimsbevis, fondaktierätt och teckningsrätt, samt

2. överlåtbart värdepapper, såsom konvertibel där rätten att begära konvertering tillkommer emittenten och teckningsoption, som ger rätt att förvärva sådant värdepapper som avses i 1 genom konvertering eller utövande av annan rättighet som värdepapperet är bärare av, om värdepapperet utfärdats av emittenten av den aktie som rättigheten hänför sig till eller av ett bolag som ingår i samma koncern som den emittenten,

kvalificerade investerare:

1. juridiska personer med tillstånd att verka på finansmarknaderna,

2. juridiska personer vars verksamhet uteslutande avser investeringar i finansiella instrument,

2. juridiska personer vars verksamhet uteslutande avser investeringar i överlåtbara värdepapper,

3. stater, delstater, statliga och delstatliga myndigheter, centralbanker och Europeiska centralbanken samt Europeiska investeringsbanken, Internationella valutafonden och andra liknande mellanstatliga eller överstatliga organisationer,

4. juridiska personer som för vart och ett av de två senaste räkenskapsåren uppfyllt minst två av följande tre förutsättningar:

a) medeltalet anställda i företaget har uppgått till minst 250,

b) nettovärdet av tillgångarna enligt balansräkningen har överstigit motsvarande 43 miljoner euro, och

c) nettoomsättningen enligt resultaträkningen har överstigit motsvarande 50 miljoner euro, samt

5. andra juridiska personer än de som omfattas av 1–4 och fysiska personer, om de av någon annan stat inom EES betraktas som kvalificerade investerare,

TP

2

PT

EUT L 345, 31.12.2003, s. 64 (Celex 32003L0071).

TP

3

PT

EUT L 186, 18.7.2005, s. 3 (Celex 32004R0809).

113

U

emissionsprogram

U

: ett program

för utgivning av icke aktierelaterade finansiella instrument av likartad sort eller kategori, fortlöpande eller vid upprepade tillfällen under en särskilt angiven emissionsperiod,

U

emissionsprogram

U

: ett program

för utgivning av icke aktierelaterade överlåtbara värdepapper av likartad sort eller kategori, fortlöpande eller vid upprepade tillfällen under en särskilt angiven emissionsperiod,

offentligt uppköpserbjudande: ett offentligt erbjudande till innehavare av aktier som har getts ut av ett svenskt eller utländskt bolag att överlåta samtliga eller en del av dessa aktier till budgivaren,

budgivare: den som lämnar ett offentligt uppköpserbjudande, målbolag: bolag till vars aktieägare ett offentligt uppköpserbjudande lämnas, och

öppenhetsdirektivet: Europaparlamentets och rådets direktiv 2004/109/EG av den 15 december 2004 om harmonisering av insynskraven angående upplysningar om emittenter vars värdepapper är upptagna till handel på en reglerad marknad och om ändring av direktiv 2001/34/EG

TPF

4

FPT

.

Nuvarande lydelse Föreslagen lydelse

2 kap.

1 §

TPF

5

FPT

Ett prospekt skall upprättas när finansiella instrument som är avsedda för allmän omsättning erbjuds till allmänheten eller tas upp till handel på en reglerad marknad, om inte annat följer av 2–7 §§.

Ett prospekt skall upprättas när överlåtbara värdepapper erbjuds till allmänheten eller tas upp till handel på en reglerad marknad, om inte något annat följer av 2– 7 §§.

2 §

TPF

6

FPT

Bestämmelserna om prospekt i denna lag tillämpas inte, om de finansiella instrumenten utgörs av

Bestämmelserna om prospekt i denna lag tillämpas inte, om de överlåtbara värdepapperen utgörs av

1. andelar i en investeringsfond eller i ett sådant fondföretag som avses i 1 kap. 7 eller 9 § lagen (2004:46) om investeringsfonder, eller

2. fordringsrätter med kortare löptid än ett år.

2. penningmarknadsinstrument med kortare löptid än ett år.

3 §

TPF

7

FPT

Prospekt behöver inte upprättas, om de finansiella instrumenten

Prospekt behöver inte upprättas, om de överlåtbara värdepapperen

1. villkorslöst och oåterkalleligt garanteras av en stat inom EES eller av ett landsting eller en kommun eller en motsvarande regional eller lokal myndighet inom EES, eller

TP

4

PT

EUT L 390, 31.12.2004, s. 38 (Celex 32004L0109).

TP

5

PT

Senaste lydelse 2005:833.

TP

6

PT

Senaste lydelse 2005:833.

TP

7

PT

Senaste lydelse 2005:833.

114

2. utgörs av icke aktierelaterade finansiella instrument som ges ut av en stat eller en centralbank inom EES, av ett landsting eller en kommun eller en motsvarande regional eller lokal myndighet inom EES eller av en mellanstatlig organisation i vilken en eller flera stater inom EES är medlemmar.

2. utgörs av icke aktierelaterade överlåtbara värdepapper som ges ut av en stat eller en centralbank inom EES, av ett landsting eller en kommun eller en motsvarande regional eller lokal myndighet inom EES eller av en mellanstatlig organisation i vilken en eller flera stater inom EES är medlemmar.

4 §

TPF

8

FPT

När finansiella instrument erbjuds till allmänheten behöver ett prospekt inte upprättas, om

När överlåtbara värdepapper erbjuds till allmänheten behöver ett prospekt inte upprättas, om

1. erbjudandet riktas bara till kvalificerade investerare,

2. erbjudandet riktas till mindre än hundra fysiska eller juridiska personer, som inte är kvalificerade investerare, i en stat inom EES,

3. erbjudandet avser köp av finansiella instrument till ett belopp motsvarande minst 50 000 euro för varje investerare,

3. erbjudandet avser köp av överlåtbara värdepapper till ett belopp motsvarande minst 50 000 euro för varje investerare,

4. vart och ett av de finansiella instrumenten har ett nominellt värde som motsvarar minst 50 000 euro, eller

4. vart och ett av de överlåtbara värdepapperen har ett nominellt värde som motsvarar minst 50 000 euro, eller

5. det belopp som sammanlagt skall betalas av investerarna under en tid av tolv månader motsvarar högst 1 miljon euro.

5 §

TPF

9

FPT

När finansiella instrument erbjuds till allmänheten behöver ett prospekt inte upprättas, om erbjudandet avser

När överlåtbara värdepapper erbjuds till allmänheten behöver ett prospekt inte upprättas, om erbjudandet avser

1. aktier som emitteras i utbyte mot aktier av samma slag och emissionen inte innebär någon ökning av bolagets aktiekapital,

2. finansiella instrument som erbjuds som vederlag i samband med ett offentligt uppköpserbjudande, när Finansinspektionen har godkänt en erbjudandehandling som avses i 2 kap. lagen (2006:451) om offentliga uppköpserbjudanden på aktiemarknaden,

2. överlåtbara värdepapper som erbjuds som vederlag i samband med ett offentligt uppköpserbjudande, när Finansinspektionen har godkänt en erbjudandehandling som avses i 2 kap. lagen (2006:451) om offentliga uppköpserbjudanden på aktiemarknaden,

3. aktier som erbjuds, tilldelas eller skall tilldelas i samband med en fusion, när det har upprättats ett dokument som har granskats av Finansinspektionen enligt bestämmelserna i 2 b kap. och inspektionen

TP

8

PT

Senaste lydelse 2005:833.

TP

9

PT

Senaste lydelse 2006:454.

115

inte har meddelat beslut enligt 2 b kap. 3 § om att ett prospekt skall upprättas,

4. aktier som erbjuds, tilldelas eller skall tilldelas aktieägarna utan kostnad och utdelning av vinst som sker i form av aktier av samma slag som de aktier som utdelningen hänför sig till, när ett dokument som innehåller information om aktierna samt om motiven och de närmare formerna för erbjudandet görs tillgängligt, eller

5. finansiella instrument som nuvarande eller tidigare anställda eller styrelseledamöter i ett företag erbjuds, tilldelas eller skall tilldelas av företaget eller av ett närstående företag, när instrumenten är av samma slag som de instrument som redan finns upptagna till handel på en reglerad marknad eller hänför sig till dem och ett dokument som innehåller information om de finansiella instrumenten samt om motiven och de närmare formerna för erbjudandet görs tillgängligt.

5. överlåtbara värdepapper som nuvarande eller tidigare anställda eller styrelseledamöter i ett företag erbjuds, tilldelas eller skall tilldelas av företaget eller av ett närstående företag, när värdepapperen är av samma slag som de värdepapper som redan finns upptagna till handel på en reglerad marknad eller hänför sig till dem och ett dokument som innehåller information om de överlåtbara värdepapperen samt om motiven och de närmare formerna för erbjudandet görs tillgängligt.

6 §

TPF

10

FPT

När finansiella instrument tas upp till handel på en reglerad marknad behöver ett prospekt inte upprättas, om

När överlåtbara värdepapper tas upp till handel på en reglerad marknad behöver ett prospekt inte upprättas, om

1. antalet aktier, för vilka ansökts om upptagande till handel under de senaste tolv månaderna, motsvarar mindre än tio procent av det antal aktier av samma slag som vid början av tolvmånadersperioden var upptagna till handel på samma reglerade marknad,

2. aktier emitteras i utbyte mot aktier av samma slag, som redan finns upptagna till handel på samma reglerade marknad och emissionen inte innebär någon ökning av bolagets aktiekapital,

3. finansiella instrument erbjuds som vederlag i samband med ett offentligt uppköpserbjudande, när Finansinspektionen har godkänt en erbjudandehandling som avses i 2 kap. lagen (2006:451) om offentliga uppköpserbjudanden på aktiemarknaden,

3. överlåtbara värdepapper erbjuds som vederlag i samband med ett offentligt uppköpserbjudande, när Finansinspektionen har godkänt en erbjudandehandling som avses i 2 kap. lagen (2006:451) om offentliga uppköpserbjudanden på aktiemarknaden,

4. aktier erbjuds, tilldelas eller skall tilldelas i samband med en fusion, när det har upprättats ett dokument som har granskats av Finansinspektionen enligt bestämmelserna i 2 b kap. och inspektionen inte har meddelat beslut enligt 2 b kap. 3 § om att ett prospekt skall upprättas,

TP

10

PT

Senaste lydelse 2006:454.

116

5. aktier erbjuds, tilldelas eller skall tilldelas aktieägarna utan kostnad och om utdelning av vinst sker i form av aktier av samma slag som de aktier som utdelningen hänför sig till, när aktierna är av samma slag som de aktier som redan finns upptagna till handel på samma reglerade marknad och ett dokument som innehåller information om aktierna samt om motiven och de närmare formerna för erbjudandet görs tillgängligt,

6. finansiella instrument som nuvarande eller tidigare anställda eller styrelseledamöter i ett företag erbjuds, tilldelas eller skall tilldelas av företaget eller av ett närstående företag, när instrumenten är av samma slag som de instrument som redan finns upptagna till handel på samma reglerade marknad och ett dokument som innehåller information om de finansiella instrumenten samt om motiven och de närmare formerna för erbjudandet görs tillgängligt, eller

6. överlåtbara värdepapper som nuvarande eller tidigare anställda eller styrelseledamöter i ett företag erbjuds, tilldelas eller skall tilldelas av företaget eller av ett närstående företag, när värdepapperen är av samma slag som de värdepapper som redan finns upptagna till handel på samma reglerade marknad och ett dokument som innehåller information om de överlåtbara värdepapperen samt om motiven och de närmare formerna för erbjudandet görs tillgängligt, eller

7. aktier har tillkommit genom konvertering eller utbyte av finansiella instrument eller genom utnyttjande av teckningsoptioner, när aktierna är av samma slag som de aktier som redan finns upptagna till handel på samma reglerade marknad.

7. aktier har tillkommit genom konvertering eller utbyte av överlåtbara värdepapper eller genom utnyttjande av teckningsoptioner, när aktierna är av samma slag som de aktier som redan finns upptagna till handel på samma reglerade marknad.

7 §

TPF

11

FPT

När finansiella instrument tas upp till handel på en reglerad marknad behöver ett prospekt inte upprättas då finansiella instrument av samma kategori sedan mer än 18 månader är upptagna till handel på en annan reglerad marknad inom EES, om

När överlåtbara värdepapper tas upp till handel på en reglerad marknad behöver ett prospekt inte upprättas då överlåtbara värdepapper av samma kategori sedan mer än 18 månader är upptagna till handel på en annan reglerad marknad, om

1. de finansiella instrumenten av samma kategori togs upp till handel på den andra reglerade marknaden med stöd av

1. de överlåtbara värdepapperen av samma kategori togs upp till handel på den andra reglerade marknaden med stöd av

a) ett godkänt prospekt som offentliggjorts enligt regler motsvarande dem i 28–30 §§ och instrumenten togs upp till handel för första gången efter den 31 december 2003, eller

a) ett godkänt prospekt som offentliggjorts enligt regler motsvarande dem i 28–30 §§ och värdepapperen togs upp till handel för första gången efter den 31 december 2003, eller

TP

11

PT

Senaste lydelse 2005:833.

117

b) ett prospekt som godkänts enligt kraven i rådets direktiv 80/390/EEG av den 17 mars 1980 om samordning av kraven på upprättande, granskning och spridning av prospekt som skall offentliggöras vid upptagande av värdepapper till officiell notering vid fondbörs

TPF

12

FPT

eller Europa-

parlamentets och rådets direktiv 2001/34/EG av den 28 maj 2001 om upptagande av värdepapper till officiell notering och om uppgifter som skall offentliggöras beträffande sådana värdepapper

TPF

13

FPT

och

instrumenten togs upp till handel före den 1 januari 2004,

b) ett prospekt som godkänts enligt kraven i rådets direktiv 80/390/EEG av den 17 mars 1980 om samordning av kraven på upprättande, granskning och spridning av prospekt som skall offentliggöras vid upptagande av värdepapper till officiell notering vid fondbörs

TPF

14

FPT

, senast ändrat

genom Europaparlamentets och rådets direktiv 94/18/EG

TPF

15

FPT

, eller

Europaparlamentets och rådets direktiv 2001/34/EG av den 28 maj 2001 om upptagande av värdepapper till officiell notering och om uppgifter som skall offentliggöras beträffande sådana värdepapper

TPF

16

FPT

, senast ändrat genom

Europaparlamentets och rådets direktiv 2005/1/EG

TPF

17

FPT

, och värde-

papperen togs upp till handel före den 1 januari 2004,

2. emittenten har fullgjort löpande skyldigheter på den andra reglerade marknaden, och

3. den som ansöker om att de finansiella instrumenten skall tas upp till handel på den reglerade marknaden upprättar ett sammanfattande dokument på ett språk som Finansinspektionen i ett enskilt fall beslutar och offentliggör dokumentet enligt 29 §.

3. den som ansöker om att de överlåtbara värdepapperen skall tas upp till handel på den reglerade marknaden upprättar ett sammanfattande dokument på ett språk som Finansinspektionen i ett enskilt fall beslutar och offentliggör dokumentet enligt 29 §.

Dokumentet enligt första stycket 3 skall innehålla information motsvarande den som enligt 14 § skall ingå i en sammanfattning. Dokumentet skall även innehålla information om var det senaste godkända prospektet kan fås och var den finansiella information som emittenten offentliggjort till följd av löpande krav på offentliggörande finns tillgänglig.

9 §

TPF

18

FPT

Vid ett erbjudande till allmänheten som innefattar emission av finansiella instrument skall prospektet upprättas av emittenten.

Vid ett erbjudande till allmänheten som innefattar emission av överlåtbara värdepapper skall prospektet upprättas av emittenten.

TP

12

PT

EGT L 100, 17.4.1980, s. 1 (Celex 31980L0390).

TP

13

PT

EGT L 184, 6.7.2001, s. 1 (Celex 32001L0034).

TP

14

PT

EGT L 100, 17.4.1980, s. 1 (Celex 31980L0390).

TP

15

PT T

EGT L 135, 31.5.1994, s. 1

T

(Celex 31994L0018).

TP

16

PT

EGT L 184, 6.7.2001, s. 1 (Celex 32001L0034).

TP

17

PT

EUT L 79, 24.3.2005, s. 9 (Celex 32005L0001).

TP

18

PT

Senaste lydelse 2005:833.

118

Vid ett erbjudande till allmänheten om köp av aktier, konvertibler, teckningsoptioner eller teckningsrätter som lämnas av någon som innehar sådana finansiella instrument skall prospektet upprättas av det aktiebolag som har gett ut instrumenten. Den som avser att lämna ett sådant erbjudande skall underrätta styrelsen i bolaget senast sex veckor före den dag då köp tidigast avses ske.

Vid ett erbjudande till allmänheten om köp av aktier, konvertibler, teckningsoptioner eller teckningsrätter som lämnas av någon som innehar sådana överlåtbara värdepapper skall prospektet upprättas av det aktiebolag som har gett ut värdepapperen. Den som avser att lämna ett sådant erbjudande skall underrätta styrelsen i bolaget senast sex veckor före den dag då köp tidigast avses ske.

Vid andra erbjudanden till allmänheten än sådana som avses i första och andra styckena skall prospektet upprättas av den som lämnar erbjudandet.

Ett aktiebolag får ta ut ersättning för sina kostnader för att upprätta ett prospekt enligt andra stycket av den som lämnar erbjudandet. Om erbjudandet lämnas av flera, skall kostnaderna fördelas mellan dem i förhållande till det antal instrument av samma slag som var och en erbjuder till allmänheten.

Ett aktiebolag får ta ut ersättning för sina kostnader för att upprätta ett prospekt enligt andra stycket av den som lämnar erbjudandet. Om erbjudandet lämnas av flera, skall kostnaderna fördelas mellan dem i förhållande till det antal värdepapper av samma slag som var och en erbjuder till allmänheten.

10 §

TPF

19

FPT

Vid en ansökan om att finansiella instrument skall tas upp till handel på en reglerad marknad skall prospektet upprättas av den som gör ansökan.

Vid en ansökan om att överlåtbara värdepapper skall tas upp till handel på en reglerad marknad skall prospektet upprättas av den som gör ansökan.

11 §

TPF

20

FPT

Ett prospekt skall innehålla all information rörande emittenten och de finansiella instrumenten som är nödvändig för att en investerare skall kunna göra en välgrundad bedömning av emittentens och en eventuell garants tillgångar och skulder, finansiella ställning, resultat och framtidsutsikter samt av de finansiella instrumenten. Informationen skall vara skriven så att den är lätt att förstå och analysera.

Ett prospekt skall innehålla all information rörande emittenten och de överlåtbara värdepapperen som är nödvändig för att en investerare skall kunna göra en välgrundad bedömning av emittentens och en eventuell garants tillgångar och skulder, finansiella ställning, resultat och framtidsutsikter samt av de överlåtbara värdepapperen. Informationen skall vara skriven så att den är lätt att förstå och analysera.

TP

19

PT

Senaste lydelse 2005:833.

TP

20

PT

Senaste lydelse 2005:833.

119

Ytterligare bestämmelser om den information som ett prospekt skall innehålla finns i prospektförordningen.

13 §

TPF

21

FPT

Ett prospekt skall upprättas som ett eller tre separata dokument. I det senare fallet skall informationen i prospektet delas upp i ett registreringsdokument, en värdepappersnot och en sammanfattning. Av

16 § framgår att ett prospekt i vissa fall får upprättas i form av ett grundprospekt.

Registreringsdokumentet skall innehålla information om emittenten. Värdepappersnoten skall innehålla information om de finansiella instrumenten. Sammanfattningen skall innehålla de uppgifter som anges i 14 §.

Registreringsdokumentet skall innehålla information om emittenten. Värdepappersnoten skall innehålla information om de överlåtbara värdepapperen. Sammanfattningen skall innehålla de uppgifter som anges i 14 §.

Om en emittent har ett registreringsdokument som är godkänt och registrerat av Finansinspektionen och giltigt enligt 24 §, räcker det med att emittenten upprättar en värdepappersnot och en sammanfattning när finansiella instrument erbjuds till allmänheten eller tas upp till handel på en reglerad marknad. Har det, efter det att det senaste registreringsdokumentet och eventuella tillägg enligt 34 § godkänts, inträffat en förändring eller händelse som skulle kunna påverka en investerares bedömning, skall värdepappersnoten innehålla information om detta, även om sådan information normalt skulle ha lämnats i registreringsdokumentet. Värdepappersnoten och sammanfattningen skall godkännas av Finansinspektionen enligt 25 §.

Om en emittent har ett registreringsdokument som är godkänt och registrerat av Finansinspektionen och giltigt enligt 24 §, räcker det med att emittenten upprättar en värdepappersnot och en sammanfattning när överlåtbara värdepapper erbjuds till allmänheten eller tas upp till handel på en reglerad marknad. Har det, efter det att det senaste registreringsdokumentet och eventuella tillägg enligt 34 § godkänts, inträffat en förändring eller händelse som skulle kunna påverka en investerares bedömning, skall värdepappersnoten innehålla information om detta, även om sådan information normalt skulle ha lämnats i registreringsdokumentet. Värdepappersnoten och sammanfattningen skall godkännas av Finansinspektionen enligt 25 §.

14 §

TPF

22

FPT

I ett prospekt skall det ingå en kortfattad sammanfattning som är lätt att förstå. Den skall förmedla väsentliga uppgifter om och risker som är förenade med emittenten, eventuell garant och de finansiella

I ett prospekt skall det ingå en kortfattad sammanfattning som är lätt att förstå. Den skall förmedla väsentliga uppgifter om och risker som är förenade med emittenten, eventuell garant och de överlåt-

TP

21

PT

Senaste lydelse 2005:833.

TP

22

PT

Senaste lydelse 2005:833.

120

instrumenten. bara värdepapperen.

Sammanfattningen skall även innehålla uppgift om

1. att den skall ses som en introduktion till prospektet, 2. att varje beslut om att investera i de finansiella instrumenten skall grunda sig på en bedömning av prospektet i dess helhet,

2. att varje beslut om att investera i de överlåtbara värdepapperen skall grunda sig på en bedömning av prospektet i dess helhet,

3. att en investerare som väcker talan vid domstol med anledning av uppgifterna i ett prospekt kan bli tvungen att svara för kostnaderna för översättning av prospektet, och

4. innehållet i 15 §. Prospektet behöver inte innehålla en sammanfattning, om det upprättas när icke aktierelaterade finansiella instrument, som vart och ett har ett nominellt värde som motsvarar minst 50 000 euro, tas upp till handel på en reglerad marknad.

Prospektet behöver inte innehålla en sammanfattning, om det upprättas när icke aktierelaterade överlåtbara värdepapper, som vart och ett har ett nominellt värde som motsvarar minst 50 000 euro, tas upp till handel på en reglerad marknad.

16 §

TPF

23

FPT

Ett prospekt får upprättas i form av ett grundprospekt, om de finansiella instrumenten utgörs av

Ett prospekt får upprättas i form av ett grundprospekt, om de överlåtbara värdepapperen utgörs av

1. icke aktierelaterade finansiella instrument som ges ut inom ramen för ett emissionsprogram,

1. icke aktierelaterade överlåtbara värdepapper som ges ut inom ramen för ett emissionsprogram,

2. skuldförbindelser som avses i lagen (2003:1223) om utgivning av säkerställda obligationer och som ges ut fortlöpande eller vid upprepade tillfällen, eller

3. bostadsobligationer som vid upprepade tillfällen erbjuds till allmänheten i Sverige av ett kreditinstitut vars främsta syfte är att bevilja hypotekslån, förutsatt att

a) obligationerna utgör delar av ett lån avsett att utfärdas i omgångar under en särskilt angiven emissionsperiod,

b) emissionsvillkoren inte ändras under emissionsperioden, och c) de belopp som erhålls från emissionerna enligt emittentens bolagsordning placeras i tillgångar som ger tillräcklig täckning för de åtaganden som är förenade med obligationerna.

Ett grundprospekt behöver inte innehålla de slutliga villkoren för ett erbjudande av finansiella instrument till allmänheten.

Ett grundprospekt behöver inte innehålla de slutliga villkoren för ett erbjudande av överlåtbara värdepapper till allmänheten.

TP

23

PT

Senaste lydelse 2005:833.

121

17 §

TPF

24

FPT

Om ett grundprospekt eller ett tillägg till detta inte innehåller de slutliga villkoren för ett erbjudande av finansiella instrument till allmänheten, skall villkoren ges in till Finansinspektionen och offentliggöras enligt 29 § så snart det är möjligt.

Om ett grundprospekt eller ett tillägg till detta inte innehåller de slutliga villkoren för ett erbjudande av överlåtbara värdepapper till allmänheten, skall villkoren ges in till Finansinspektionen och offentliggöras enligt 29 § så snart det är möjligt.

18 §

TPF

25

FPT

Om det slutliga priset eller det antal finansiella instrument som skall erbjudas till allmänheten inte kan anges i prospektet, får sådana uppgifter utelämnas. I så fall skall en investerare ha rätt att återkalla sin anmälan om köp eller teckning av de finansiella instrumenten, om prospektet inte i stället innehåller uppgifter om de kriterier eller villkor som skall tillämpas för att fastställa priset eller antalet finansiella instrument eller, när det gäller priset, det högsta priset.

Om det slutliga priset eller det antal överlåtbara värdepapper som skall erbjudas till allmänheten inte kan anges i prospektet, får sådana uppgifter utelämnas. I så fall skall en investerare ha rätt att återkalla sin anmälan om köp eller teckning av de överlåtbara värdepapperen, om prospektet inte i stället innehåller uppgifter om de kriterier eller villkor som skall tillämpas för att fastställa priset eller antalet överlåtbara värdepapper eller, när det gäller priset, det högsta priset.

När priset eller antalet finansiella instrument har fastställts slutligt, skall dessa uppgifter ges in till Finansinspektionen och offentliggöras enligt 29 §.

När priset eller antalet överlåtbara värdepapper har fastställts slutligt, skall dessa uppgifter ges in till Finansinspektionen och offentliggöras enligt 29 §.

En återkallelse enligt första stycket får göras inom fem arbetsdagar från det att slutligt fastställt pris och antal finansiella instrument har offentliggjorts.

En återkallelse enligt första stycket får göras inom fem arbetsdagar från det att slutligt fastställt pris och antal överlåtbara värdepapper har offentliggjorts.

19 §

TPF

26

FPT

Finansinspektionen får i ett enskilt fall besluta att information som krävs enligt 11 § första stycket eller enligt prospektförordningen får utelämnas i ett prospekt, om inspektionen finner att

1. offentliggörandet av informationen skulle medföra allvarlig skada för emittenten, och utelämnandet av informationen inte kan antas medföra att allmänheten vilseleds i fråga om omständig-

1. offentliggörandet av informationen skulle medföra allvarlig skada för emittenten, och utelämnandet av informationen inte kan antas medföra att allmänheten vilseleds i fråga om omständig-

TP

24

PT

Senaste lydelse 2005:833.

TP

25

PT

Senaste lydelse 2005:833.

TP

26

PT

Senaste lydelse 2005:833.

122

heter som är av väsentlig betydelse för att en välgrundad bedömning skall kunna göras beträffande emittenten, den som lämnar erbjudandet eller eventuell garant och de finansiella instrument som prospektet avser, eller

heter som är av väsentlig betydelse för att en välgrundad bedömning skall kunna göras beträffande emittenten, den som lämnar erbjudandet eller eventuell garant och de överlåtbara värdepapper som prospektet avser, eller

2. informationen är av mindre betydelse och inte skulle påverka bedömningen beträffande den finansiella ställningen hos och framtidsutsikterna för emittenten, den som lämnar erbjudandet eller en eventuell garant.

Information som krävs enligt prospektförordningen får i särskilda fall utelämnas, om den inte är relevant för emittentens verksamhetsområde eller rättsliga form eller för de finansiella instrument som prospektet avser. Om det är möjligt, skall prospektet innehålla likvärdig information.

Information som krävs enligt prospektförordningen får i särskilda fall utelämnas, om den inte är relevant för emittentens verksamhetsområde eller rättsliga form eller för de överlåtbara värdepapper som prospektet avser. Om det är möjligt, skall prospektet innehålla likvärdig information.

21 §

TPF

27

FPT

När finansiella instrument erbjuds till allmänheten eller tas upp till handel på en reglerad marknad i Sverige, skall prospektet upprättas på svenska, om inte Finansinspektionen i ett enskilt fall beslutar att det får upprättas på ett annat språk eller detta följer av andra stycket eller 23 §.

När överlåtbara värdepapper erbjuds till allmänheten eller tas upp till handel på en reglerad marknad i Sverige, skall prospektet upprättas på svenska, om inte Finansinspektionen i ett enskilt fall beslutar att det får upprättas på ett annat språk eller detta följer av andra stycket eller 23 §.

När ett prospekt avser icke aktierelaterade finansiella instrument som vart och ett har ett nominellt värde som motsvarar minst 50 000 euro och som skall tas upp till handel på en reglerad marknad i Sverige, får prospektet upprättas på ett språk som används allmänt på de internationella finansiella marknaderna.

När ett prospekt avser icke aktierelaterade överlåtbara värdepapper som vart och ett har ett nominellt värde som motsvarar minst 50 000 euro och som skall tas upp till handel på en reglerad marknad i Sverige, får prospektet upprättas på ett språk som används allmänt på de internationella finansiella marknaderna.

22 §

TPF

28

FPT

När finansiella instrument erbjuds till allmänheten eller tas upp till handel på en reglerad marknad i en eller flera stater inom

När överlåtbara värdepapper erbjuds till allmänheten eller tas upp till handel på en reglerad marknad i en eller flera stater inom

TP

27

PT

Senaste lydelse 2005:833.

TP

28

PT

Senaste lydelse 2005:833.

123

EES, men inte i Sverige, skall det prospekt som ges in till Finansinspektionen för godkännande enligt 25 § upprättas på svenska, på ett språk som används allmänt på de internationella finansiella marknaderna eller på något annat språk som inspektionen i ett enskilt fall beslutar.

EES, men inte i Sverige, skall det prospekt som ges in till Finansinspektionen för godkännande enligt 25 § upprättas på svenska, på ett språk som används allmänt på de internationella finansiella marknaderna eller på något annat språk som inspektionen i ett enskilt fall beslutar.

23 §

TPF

29

FPT

Om ett prospekt har godkänts av en behörig myndighet i en annan stat inom EES enligt 36 § och avser ett erbjudande av finansiella instrument till allmänheten i Sverige eller en ansökan om att finansiella instrument skall tas upp till handel på en reglerad marknad i Sverige, får prospektet vara avfattat på ett språk som används allmänt på de internationella finansiella marknaderna. Finansinspektionen får dock besluta att en sammanfattning av prospektet skall översättas till svenska.

Om ett prospekt har godkänts av en behörig myndighet i en annan stat inom EES enligt 36 § och avser ett erbjudande av överlåtbara värdepapper till allmänheten i Sverige eller en ansökan om att överlåtbara värdepapper skall tas upp till handel på en reglerad marknad i Sverige, får prospektet vara avfattat på ett språk som används allmänt på de internationella finansiella marknaderna. Finansinspektionen får dock besluta att en sammanfattning av prospektet skall översättas till svenska.

24 §

TPF

30

FPT

Ett prospekt enligt 13 § eller ett grundprospekt enligt 16 § första stycket 1 är giltigt under en tid av högst tolv månader från den dag då det offentliggörs enligt 28 §.

Ett grundprospekt enligt 16 § första stycket 2 eller 3 är giltigt så länge det ges ut finansiella instrument enligt prospektet.

Ett grundprospekt enligt 16 § första stycket 2 eller 3 är giltigt så länge det ges ut överlåtbara värdepapper enligt prospektet.

Prospekt är giltiga enligt första och andra styckena bara om eventuella tillägg görs enligt 34 §.

26 §

TPF

31

FPT

Finansinspektionen skall meddela beslut med anledning av ansökan om godkännande inom tio arbetsdagar från det att en fullständig ansökan kom in till inspektionen. Om ett erbjudande

Finansinspektionen skall meddela beslut med anledning av ansökan om godkännande inom tio arbetsdagar från det att en fullständig ansökan kom in till inspektionen. Om ett erbjudande

TP

29

PT

Senaste lydelse 2005:833.

TP

30

PT

Senaste lydelse 2005:833.

TP

31

PT

Senaste lydelse 2005:833.

124

till allmänheten avser finansiella instrument som ges ut av en emittent som inte tidigare har erbjudit finansiella instrument till allmänheten och som inte tidigare har fått finansiella instrument upptagna till handel på en reglerad marknad, skall Finansinspektionen meddela beslut inom tjugo arbetsdagar från det att en fullständig ansökan kom in till inspektionen.

till allmänheten avser överlåtbara värdepapper som ges ut av en emittent som inte tidigare har erbjudit överlåtbara värdepapper till allmänheten och som inte tidigare har fått överlåtbara värdepapper upptagna till handel på en reglerad marknad, skall Finansinspektionen meddela beslut inom tjugo arbetsdagar från det att en fullständig ansökan kom in till inspektionen.

Om en ansökan behöver kompletteras, skall Finansinspektionen snarast och senast inom tio arbetsdagar från det att ansökan kom in till inspektionen, underrätta sökanden och begära nödvändiga kompletteringar.

När ett prospekt har godkänts, skall Finansinspektionen registrera det.

28 §

TPF

32

FPT

Ett prospekt skall offentliggöras, när det har godkänts och registrerats av Finansinspektionen.

Prospektet skall offentliggöras av emittenten, den som lämnar erbjudandet eller den som ansöker om att finansiella instrument skall tas upp till handel på en reglerad marknad snarast och senast dagen innan anmälningstiden i erbjudandet börjar löpa eller de finansiella instrumenten tas upp till handel. Om ett slag av aktier som inte tidigare har tagits upp till handel erbjuds till allmänheten och skall tas upp till handel, skall prospektet offentliggöras minst sex arbetsdagar innan erbjudandet löper ut.

Prospektet skall offentliggöras av emittenten, den som lämnar erbjudandet eller den som ansöker om att överlåtbara värdepapper skall tas upp till handel på en reglerad marknad snarast och senast dagen innan anmälningstiden i erbjudandet börjar löpa eller de överlåtbara värdepapperen tas upp till handel. Om ett slag av aktier som inte tidigare har tagits upp till handel erbjuds till allmänheten och skall tas upp till handel, skall prospektet offentliggöras minst sex arbetsdagar innan erbjudandet löper ut.

29 §

TPF

33

FPT

Ett prospekt skall offentliggöras

1. i en eller flera dagstidningar med rikstäckande eller omfattande spridning i de stater inom EES där ett erbjudande av finansiella instrument till allmänheten eller en ansökan om att finansiella instrument skall tas upp till handel görs,

1. i en eller flera dagstidningar med rikstäckande eller omfattande spridning i de stater inom EES där ett erbjudande av överlåtbara värdepapper till allmänheten eller en ansökan om att överlåtbara värdepapper skall tas upp till handel görs,

TP

32

PT

Senaste lydelse 2005:833.

TP

33

PT

Senaste lydelse 2005:833.

125

2. genom att i tryckt form kostnadsfritt göras tillgängligt för allmänheten hos de reglerade marknader där de finansiella instrumenten tas upp till handel eller på emittentens huvudkontor och, i förekommande fall, hos värdepappersinstitut som medverkar vid erbjudandet,

2. genom att i tryckt form kostnadsfritt göras tillgängligt för allmänheten hos de reglerade marknader där de överlåtbara värdepapperen tas upp till handel eller på emittentens huvudkontor och, i förekommande fall, hos värdepappersinstitut som medverkar vid erbjudandet,

3. på emittentens elektroniska hemsida samt, i de fall värdepappersinstitut medverkar vid erbjudandet, på värdepappersinstitutets elektroniska hemsida, eller

4. på en elektronisk hemsida som tillhör den reglerade marknad där ansökan om att finansiella instrument skall tas upp till handel görs.

4. på en elektronisk hemsida som tillhör den reglerade marknad där ansökan om att överlåtbara värdepapper skall tas upp till handel görs.

Om ett prospekt offentliggörs av emittenten enligt första stycket 1 eller 2, skall prospektet även offentliggöras på emittentens elektroniska hemsida samt, i de fall värdepappersinstitut medverkar vid erbjudandet, på värdepappersinstitutets elektroniska hemsida.

30 §

TPF

34

FPT

Om ett prospekt offentliggörs i elektronisk form, skall investerare som begär det kostnadsfritt få en papperskopia av prospektet från emittenten, den som lämnar erbjudandet, den som ansöker om att finansiella instrument skall tas upp till handel eller värdepappersinstitut som medverkar vid erbjudandet.

Om ett prospekt offentliggörs i elektronisk form, skall investerare som begär det kostnadsfritt få en papperskopia av prospektet från emittenten, den som lämnar erbjudandet, den som ansöker om att överlåtbara värdepapper skall tas upp till handel eller värdepappersinstitut som medverkar vid erbjudandet.

När ett prospekt består av flera dokument eller innehåller information som har blivit en del av prospektet genom hänvisning enligt 20 §, får dokumenten eller informationen offentliggöras och spridas separat. En investerare skall i sådana fall på begäran kostnadsfritt få tillgång till en papperskopia av de olika dokumenten enligt vad som anges i 29 § första stycket 2. I varje dokument skall det anges var de övriga dokument som hör till prospektet finns att tillgå.

Ytterligare bestämmelser om offentliggörande av prospekt finns i prospektförordningen.

32 §

TPF

35

FPT

Reklam om ett erbjudande av finansiella instrument till allmänheten eller om att finansiella instrument skall tas upp till handel

Reklam om ett erbjudande av överlåtbara värdepapper till allmänheten eller om att överlåtbara värdepapper skall tas upp till

TP

34

PT

Senaste lydelse 2005:833.

TP

35

PT

Senaste lydelse 2005:833.

126

på en reglerad marknad skall innehålla information om att ett prospekt har offentliggjorts eller kommer att offentliggöras och var det finns att tillgå eller kommer att bli tillgängligt.

handel på en reglerad marknad skall innehålla information om att ett prospekt har offentliggjorts eller kommer att offentliggöras och var det finns att tillgå eller kommer att bli tillgängligt.

Reklamen skall utformas och presenteras så att det tydligt framgår att det är fråga om reklam. Information i reklam får inte vara felaktig eller vilseledande. Informationen skall stämma överens med den information som lämnas i prospektet, om detta har offentliggjorts, och annars med den information som enligt 11 § skall lämnas i ett prospekt.

Ytterligare bestämmelser om reklam finns i prospektförordningen.

33 §

TPF

36

FPT

Annan information, som inte utgör reklam, om ett erbjudande av finansiella instrument till allmänheten eller ett upptagande av finansiella instrument till handel på en reglerad marknad som lämnas av emittenten, den som lämnar erbjudandet eller den som gör ansökan om upptagande skall stämma överens med den information som lämnas i prospektet.

Annan information, som inte utgör reklam, om ett erbjudande av överlåtbara värdepapper till allmänheten eller ett upptagande av överlåtbara värdepapper till handel på en reglerad marknad som lämnas av emittenten, den som lämnar erbjudandet eller den som gör ansökan om upptagande skall stämma överens med den information som lämnas i prospektet.

Oavsett om skyldighet att upprätta prospekt föreligger eller inte, skall all väsentlig information som lämnas till någon investerare lämnas till samtliga investerare som erbjudandet riktar sig till.

Lydelse enligt prop. 2006/07:65 Föreslagen lydelse

34 §

Varje ny omständighet, sakfel eller förbiseende som kan påverka bedömningen av finansiella instrument som omfattas av ett prospekt och som inträffar eller uppmärksammas efter det att prospektet har godkänts men innan anmälningstiden för erbjudandet av finansiella instrument till allmänheten löper ut eller de finansiella instrumenten tas upp till handel på en reglerad marknad, skall tas in eller rättas till i ett tillägg till prospektet. Sammanfattningen, och eventuella översättningar av denna, skall

Varje ny omständighet, sakfel eller förbiseende som kan påverka bedömningen av överlåtbara värdepapper som omfattas av ett prospekt och som inträffar eller uppmärksammas efter det att prospektet har godkänts men innan anmälningstiden för erbjudandet av överlåtbara värdepapper till allmänheten löper ut eller de överlåtbara värdepapperen tas upp till handel på en reglerad marknad, skall tas in eller rättas till i ett tillägg till prospektet. Sammanfattningen, och eventuella översättningar av denna, skall

TP

36

PT

Senaste lydelse 2005:833.

127

kompletteras om det är nödvändigt för att återge informationen i tillägget.

kompletteras om det är nödvändigt för att återge informationen i tillägget.

Frågan om godkännande av ett tillägg till ett prospekt får prövas av Finansinspektionen, om Sverige är hemmedlemsstat. Finansinspektionen skall meddela beslut med anledning av ansökan om godkännande av ett tillägg inom sju arbetsdagar från det att ansökan kom in till inspektionen. Tillägget skall därefter offentliggöras på samma sätt som prospektet har offentliggjorts på.

En investerare som innan tillägget till prospektet offentliggörs har gjort en anmälan om eller på annat sätt samtyckt till köp eller teckning av de finansiella instrument som omfattas av prospektet, har rätt att återkalla sin anmälan eller sitt samtycke inom fem arbetsdagar från offentliggörandet.

En investerare som innan tillägget till prospektet offentliggörs har gjort en anmälan om eller på annat sätt samtyckt till köp eller teckning av de överlåtbara värdepapper som omfattas av prospektet, har rätt att återkalla sin anmälan eller sitt samtycke inom fem arbetsdagar från offentliggörandet.

Nuvarande lydelse Föreslagen lydelse

35 §

TPF

37

FPT

När Finansinspektionen har godkänt ett prospekt, skall inspektionen, på begäran av emittenten eller den som har upprättat prospektet, överlämna ett intyg om godkännandet till behöriga myndigheter i den eller de stater inom EES där ett erbjudande av finansiella instrument till allmänheten eller ett upptagande av finansiella instrument till handel på en reglerad marknad planeras. Intyget och en kopia av prospektet skall överlämnas inom tre arbetsdagar från det att begäran kom in till inspektionen eller, om begäran bifogats ansökan om godkännande, inom en arbetsdag från godkännandet av prospektet.

När Finansinspektionen har godkänt ett prospekt, skall inspektionen, på begäran av emittenten eller den som har upprättat prospektet, överlämna ett intyg om godkännandet till behöriga myndigheter i den eller de stater inom EES där ett erbjudande av överlåtbara värdepapper till allmänheten eller ett upptagande av överlåtbara värdepapper till handel på en reglerad marknad planeras. Intyget och en kopia av prospektet skall överlämnas inom tre arbetsdagar från det att begäran kom in till inspektionen eller, om begäran bifogats ansökan om godkännande, inom en arbetsdag från godkännandet av prospektet.

Av intyget skall det framgå

1. att prospektet har upprättats i enlighet med prospektdirektivet, samt

2. om information har utelämnats enligt 19 § och i så fall skälen för detta.

Om en utländsk behörig myndighet kräver att hela eller delar av prospektet översätts, skall översättningen bifogas den begäran som ges in

TP

37

PT

Senaste lydelse 2005:833.

128

till Finansinspektionen enligt första stycket och översändas till den andra myndigheten tillsammans med intyget och kopian av prospektet.

Bestämmelserna i första–tredje styckena skall tillämpas även för eventuella tillägg som upprättas enligt 34 §.

Lydelse enligt prop. 2006/07:65 Föreslagen lydelse

37 §

Sverige är hemmedlemsstat, om emittenten har sitt säte i Sverige. Första stycket gäller inte, om en annan stat inom EES har valts som hemmedlemsstat i fråga om sådana finansiella instrument som avses i 38 § första stycket.

Första stycket gäller inte, om en annan stat inom EES har valts som hemmedlemsstat i fråga om sådana överlåtbara värdepapper som avses i 38 § första stycket.

38 §

Sverige är hemmedlemsstat, om emittenten, den som lämnar erbjudandet eller den som ansöker om att de finansiella instrumenten skall tas upp till handel på en reglerad marknad väljer Sverige som hemmedlemsstat i fråga om icke aktierelaterade finansiella instrument som antingen

Sverige är hemmedlemsstat, om emittenten, den som lämnar erbjudandet eller den som ansöker om att de överlåtbara värdepapperen skall tas upp till handel på en reglerad marknad väljer Sverige som hemmedlemsstat i fråga om icke aktierelaterade överlåtbara värdepapper som antingen

1. vart och ett har ett nominellt värde som motsvarar minst 1 000 euro, eller

2. innefattar en rätt att förvärva finansiella instrument eller få ett kontantbelopp, såvida inte emittenten har gett ut de underliggande finansiella instrumenten eller detta har gjorts av ett företag inom den koncern där emittenten ingår.

2. innefattar en rätt att förvärva överlåtbara värdepapper eller få ett kontantbelopp, såvida inte emittenten har gett ut de underliggande överlåtbara värdepapperen eller detta har gjorts av ett företag inom den koncern där emittenten ingår.

Sverige får väljas som hemmedlemsstat enligt första stycket, om det är i Sverige som de finansiella instrumenten skall erbjudas allmänheten eller har tagits eller skall tas upp till handel på en reglerad marknad.

Sverige får väljas som hemmedlemsstat enligt första stycket, om det är i Sverige som de överlåtbara värdepapperen skall erbjudas allmänheten eller har tagits eller skall tas upp till handel på en reglerad marknad.

39 §

Sverige är hemmedlemsstat om emittenten inte har säte i en stat inom EES och ger ut andra finansiella instrument än sådana som avses i 38 § första stycket, om

Sverige är hemmedlemsstat om emittenten inte har säte i en stat inom EES och ger ut andra överlåtbara värdepapper än sådana som avses i 38 § första stycket, om

1. det är i Sverige som de finan-1. det är i Sverige som de över-

129

siella instrumenten antingen kommer att erbjudas till allmänheten första gången efter den 31 december 2003 eller kommer att tas upp till handel på en reglerad marknad första gången efter det datumet, och

låtbara värdepapperen antingen kommer att erbjudas till allmänheten första gången efter den 31 december 2003 eller kommer att tas upp till handel på en reglerad marknad första gången efter det datumet, och

2. emittenten, den som lämnar erbjudandet eller den som ansöker om att de finansiella instrumenten skall tas upp till handel på en reglerad marknad väljer Sverige som hemmedlemsstat.

2. emittenten, den som lämnar erbjudandet eller den som ansöker om att de överlåtbara värdepapperen skall tas upp till handel på en reglerad marknad väljer Sverige som hemmedlemsstat.

Sverige är även hemmedlemsstat i fråga om sådana finansiella instrument som avses i första stycket när någon annan än emittenten har valt en hemmedlemsstat inom EES som inte är Sverige och emittenten senare, under samma förutsättningar som i första stycket, väljer Sverige som hemmedlemsstat.

Sverige är även hemmedlemsstat i fråga om sådana överlåtbara värdepapper som avses i första stycket när någon annan än emittenten har valt en hemmedlemsstat inom EES som inte är Sverige och emittenten senare, under samma förutsättningar som i första stycket, väljer Sverige som hemmedlemsstat.

Nuvarande lydelse Föreslagen lydelse

2 a kap.

TPF

38

FPT

Om det vederlag som erbjuds utgörs av finansiella instrument som är avsedda för allmän omsättning och ges ut eller innehas av budgivaren, skall erbjudandehandlingen utöver vad som har angetts i 2 § innehålla information som är likvärdig med den som enligt 2 kap. och prospektförordningen skall finnas i ett prospekt.

Om det vederlag som erbjuds utgörs av överlåtbara värdepapper och ges ut eller innehas av budgivaren, skall erbjudandehandlingen utöver vad som har angetts i 2 § innehålla information som är likvärdig med den som enligt 2 kap. och prospektförordningen skall finnas i ett prospekt.

6 §

TPF

39

FPT

Om Finansinspektionen finner att en erbjudandehandling som avses i 3 § inte innehåller information som är likvärdig med den som enligt 2 kap. och prospektförordningen skall finnas i ett prospekt, skall inspektionen inom

Om Finansinspektionen finner att en erbjudandehandling som avses i 3 § inte innehåller information som är likvärdig med den som enligt 2 kap. och prospektförordningen skall finnas i ett prospekt, skall inspektionen inom

TP

38

PT

Senaste lydelse 2006:454.

TP

39

PT

Senaste lydelse 2006:454.

130

tio arbetsdagar från det att en fullständig erbjudandehandling kom in till inspektionen, meddela beslut om att ett prospekt skall upprättas enligt 2 kap. Tidsfristen för Finansinspektionen att meddela ett beslut är i stället tjugo arbetsdagar från det att en fullständig erbjudandehandling kom in till inspektionen, om vederlaget utgörs av finansiella instrument som ges ut av en emittent som

tio arbetsdagar från det att en fullständig erbjudandehandling kom in till inspektionen meddela beslut om att ett prospekt skall upprättas enligt 2 kap. Tidsfristen för Finansinspektionen att meddela ett beslut är i stället tjugo arbetsdagar från det att en fullständig erbjudandehandling kom in till inspektionen, om vederlaget utgörs av överlåtbara värdepapper som ges ut av en emittent som

1. inte tidigare har erbjudit finansiella instrument till allmänheten, och

1. inte tidigare har erbjudit överlåtbara värdepapper till allmänheten, och

2. inte tidigare har fått finansiella instrument upptagna till handel på en reglerad marknad.

2. inte tidigare har fått överlåtbara värdepapper upptagna till handel på en reglerad marknad.

10 §

TPF

40

FPT

En erbjudandehandling som har godkänts av en behörig myndighet i ett annat land inom EES är giltig vid ett offentligt uppköpserbjudande som avser aktier i ett utländskt aktiebolag vars aktier är upptagna till handel på en börs eller auktoriserad marknadsplats i Sverige.

En erbjudandehandling som har godkänts av en behörig myndighet i ett annat land inom EES är giltig vid ett offentligt uppköpserbjudande som avser aktier i ett utländskt aktiebolag vars aktier är upptagna till handel på en reglerad marknad i Sverige.

Finansinspektionen får besluta att en sådan erbjudandehandling skall översättas till svenska.

Finansinspektionen får också besluta att en sådan erbjudandehandling skall innehålla uppgifter om hur ägare till aktier som är noterade på en börs eller auktoriserad marknadsplats i Sverige skall gå till väga för att acceptera erbjudandet och få vederlaget utbetalat till sig samt om beskattning av vederlaget.

Finansinspektionen får också besluta att en sådan erbjudandehandling skall innehålla uppgifter om hur ägare till aktier som är upptagna till handel på en reglerad marknad i Sverige skall gå till väga för att acceptera erbjudandet och få vederlaget utbetalat till sig samt om beskattning av vederlaget.

2 b kap.

3 §

TPF

41

FPT

Om Finansinspektionen finner att dokumentet inte är likvärdigt med ett prospekt, skall inspektionen inom tio arbetsdagar

Om Finansinspektionen finner att dokumentet inte är likvärdigt med ett prospekt, skall inspektionen inom tio arbetsdagar

TP

40

PT

Senaste lydelse 2006:454.

TP

41

PT

Senaste lydelse 2005:833.

131

från det att ett fullständigt dokument kom in till inspektionen, meddela beslut om att ett prospekt skall upprättas. Om ett överlåtande bolag och, vid absorption, det övertagande bolaget inte tidigare har erbjudit finansiella instrument till allmänheten och inte tidigare har fått finansiella instrument upptagna till handel på en reglerad marknad, är tidsfristen för Finansinspektionen att meddela ett beslut i stället tjugo arbetsdagar från det att ett fullständigt dokument kom in till inspektionen.

från det att ett fullständigt dokument kom in till inspektionen meddela beslut om att ett prospekt skall upprättas. Tidsfristen för Finansinspektionen att meddela ett beslut är i stället tjugo arbetsdagar från det att ett fullständigt dokument kom in till inspektionen, om ett överlåtande bolag och, vid absorption, det övertagande bolaget

1. inte tidigare har erbjudit överlåtbara värdepapper till allmänheten, och

2. inte tidigare har fått överlåtbara värdepapper upptagna till handel på en reglerad marknad.

Om ett dokument behöver kompletteras, skall Finansinspektionen snarast och senast inom tio arbetsdagar från det att dokumentet kom in till inspektionen, underrätta ingivaren och begära nödvändiga kompletteringar.

Lydelse enligt prop. 2006/07:65 Föreslagen lydelse

4 kap.

1 §

Bestämmelserna i 3–18, 20 och 21 §§ skall tillämpas i fråga om aktier utgivna av ett svenskt aktiebolag vars aktier är noterade vid en börs eller en auktoriserad marknadsplats eller är upptagna till handel på en reglerad marknad i en annan stat inom EES.

Bestämmelserna i 3–18, 20 och 21 §§ skall tillämpas i fråga om aktier utgivna av ett svenskt aktiebolag vars aktier är upptagna till handel på en reglerad marknad.

Bestämmelser om aktier utgivna av vissa aktiebolag som inte har säte i en stat inom EES finns i 22–24 §§.

Andra aktiebolag än sådana som avses i första eller andra stycket vars aktier är noterade vid en börs eller en auktoriserad marknadsplats skall offentliggöra information motsvarande den som anges i detta kapitel i enlighet med offentlig reglering som bygger på öppenhetsdirektivet och som har antagits av utgivarens hemmedlemsstat inom EES.

Andra aktiebolag än sådana som avses i första eller andra stycket vars aktier är upptagna till handel på en reglerad marknad i Sverige skall offentliggöra information motsvarande den som anges i detta kapitel i enlighet med offentlig reglering som bygger på öppenhetsdirektivet och som har antagits av utgivarens hemmedlemsstat inom EES.

132

14 §

Skyldigheten att enligt 3 § eller 9 § andra stycket anmäla att andelen av rösterna eller det totala antalet aktier har uppnått, överstigit eller gått ned under 5 procent gäller inte för en marknadsgarant om

1. aktierna förvärvas eller avyttras i denna egenskap,

2. marknadsgaranten har tillstånd enligt 1 kap. 3 § första stycket 3 lagen (1991:981) om värdepappersrörelse eller motsvarande tillstånd i ett annat land inom EES, och

2. marknadsgaranten har tillstånd enligt 2 kap. 1 § 3 lagen (2007:000) om värdepappersmarknaden eller motsvarande tillstånd i ett annat land inom EES, och

3. marknadsgaranten inte ingriper i förvaltningen av aktiebolaget eller utövar något inflytande över detta i syfte att bolaget skall köpa aktier utgivna av bolaget eller stödja aktiepriset.

Med marknadsgarant avses någon som på finansmarknaderna har åtagit sig att fortlöpande handla för egen räkning genom att köpa och sälja finansiella instrument med utnyttjande av eget kapital och till priser som fastställts av marknadsgaranten själv.

17 §

Ett moderföretag till ett värdepappersinstitut som har tillstånd enligt 1 kap. 3 § första stycket 4 lagen (1991:981) om värdepappersrörelse behöver inte lägga samman sitt innehav av aktier med innehav av aktier som värdepappersinstitutet förvaltar för enskilda kunder, om värdepappersinstitutet

Ett moderföretag till ett värdepappersinstitut som har tillstånd enligt 2 kap. 1 § 4 lagen (2007:000) om värdepappersmarknaden behöver inte lägga samman sitt innehav av aktier med innehav av aktier som värdepappersinstitutet förvaltar för enskilda kunder, om värdepappersinstitutet

1. bara får utnyttja rösträtten för aktierna enligt skriftliga instruktioner eller ser till att individuella portföljförvaltningstjänster utförs oberoende av alla andra tjänster och i enlighet med 1 kap. 7 § lagen om värdepappersrörelse, och

1. bara får utnyttja rösträtten för aktierna enligt skriftliga instruktioner eller ser till att individuella portföljförvaltningstjänster utförs oberoende av alla andra tjänster och i enlighet med 8 kap. 1, 10 och 21–23 §§ lagen om värdepappersmarknaden, och

2. utnyttjar rösträtten för aktierna oberoende av moderföretaget. Första stycket skall också tillämpas på ett moderföretag till ett utländskt värdepappersföretag som avses i 1 kap. 3 c § lagen om värdepappersrörelse som har tillstånd att tillhandahålla sådan portföljförvaltning som avses i punkt 3 i avsnitt A i bilagan till rådets direktiv 93/22/EEG av den 10 maj 1993 om investeringstjänster inom värdepappers-

Första stycket skall också tillämpas på ett moderföretag till ett utländskt värdepappersföretag som avses i 4 kap. 1 § lagen om värdepappersmarknaden som har tillstånd att tillhandahålla sådan portföljförvaltning som avses i artikel 4.1.9 i Europaparlamentets och rådets direktiv 2004/39/EG av den 21 april 2004 om marknader för finansiella instrument och om

133

området

TPF

42

FPT

, senast ändrat genom

Europaparlamentets och rådets direktiv 2002/87/EG

TPF

43

FPT

, i fråga om

aktier som värdepappersföretaget förvaltar för enskilda kunder. Detsamma gäller aktier som förvaltas av ett motsvarande utländskt värdepappersföretag som inte har säte i en stat inom EES.

ändring av rådets direktiv 85/611/EEG och 93/6/EEG och Europaparlamentets och rådets direktiv 2000/12/EG samt upphävande av rådets direktiv 93/22/EEG

TPF

44

FPT

, senast ändrat genom

Europaparlamentets och rådets direktiv 2006/31/EG

TPF

45

FPT

, i fråga om

aktier som värdepappersföretaget förvaltar för enskilda kunder. Detsamma gäller aktier som förvaltas av ett motsvarande utländskt värdepappersföretag som inte har säte i en stat inom EES.

19 §

Ett svenskt aktiebolag som förvärvar eller överlåter egna aktier skall anmäla förvärvet eller överlåtelsen till en svensk börs eller auktoriserad marknadsplats där aktierna är noterade. Om handeln sker i återköpsprogram enligt kommissionens förordning (EG) nr 2273/2003 av den 22 december 2003 om genomförande av Europaparlamentets och rådets direktiv 2003/6/EG när det gäller undantag för återköpsprogram och stabilisering av finansiella instrument

TPF

46

FPT

, skall anmälan i

stället göras till Finansinspektionen eller, om det framgår av föreskrifter meddelade med stöd av 7 kap. 1 § 5, till en svensk börs eller auktoriserad marknadsplats där aktierna är noterade.

Ett svenskt aktiebolag som förvärvar eller överlåter egna aktier skall anmäla förvärvet eller överlåtelsen till den börs som driver den reglerade marknad där aktierna är upptagna till handel. Om handeln sker i återköpsprogram enligt kommissionens förordning (EG) nr 2273/2003 av den 22 december 2003 om genomförande av Europaparlamentets och rådets direktiv 2003/6/EG när det gäller undantag för återköpsprogram och stabilisering av finansiella instrument

TPF

47

FPT

, skall anmälan i

stället göras till Finansinspektionen eller, om det framgår av föreskrifter meddelade med stöd av 7 kap. 1 § 5, till den börs som driver den reglerade marknad där aktierna är upptagna till handel.

21 §

Information som offentliggörs enligt 9 § första stycket eller 18 § skall samtidigt lämnas till Finansinspektionen.

Information som lämnas till Finansinspektionen enligt första stycket och information som offentliggörs av inspektionen

Information som lämnas till Finansinspektionen enligt första stycket och information som offentliggörs av inspektionen

TP

42

PT

EGT L 141, 11.6.1993, s. 27 (Celex 31993L0022).

TP

43

PT

EUT L 35, 11.2.2003, s. 1 (Celex 32002L0087).

TP

44

PT

EUT L 145, 30.4.2004, s. 1 (Celex 32004L0039).

TP

45

PT

EUT L 114, 27.4.2006, s. 60 (Celex 32006L0031).

TP

46

PT

EUT L 336, 23.12.2003, s. 33 (Celex 32003R2273).

TP

47

PT

EUT L 336, 23.12.2003, s. 33 (Celex 32003R2273).

134

enligt 11 § skall lagras elektroniskt enligt 9 a kap. 5 § lagen (1992:543) om börs- och clearingverksamhet.

enligt 11 § skall lagras elektroniskt enligt 17 kap. 4 § lagen (2007:000) om värdepappersmarknaden.

22 §

Bestämmelserna i 3–18, 20 och 21 §§ skall, om inte annat framgår av 23 och 24 §§, tillämpas också i fråga om aktier som har getts ut av ett aktiebolag som

1. inte har säte i en stat inom EES,

2. har sina aktier noterade vid en börs eller auktoriserad marknadsplats eller upptagna till handel på en reglerad marknad i en annan stat inom EES, och

2. har sina aktier upptagna till handel på en reglerad marknad, och

3. till följd av detta, eller på grund av att aktierna har erbjudits till allmänheten i Sverige, är skyldigt att ge in ett dokument enligt 6 kap. 1 b § till Finansinspektionen.

6 kap.

1 a §

För övervakningen av att bestämmelserna i denna lag, lagen (1991:981) om värdepappersrörelse, lagen (1992:543) om börs- och clearingverksamhet, lagen (2000:1087) om anmälningsskyldighet för vissa innehav av finansiella instrument, lagen (2005:377) om straff för marknadsmissbruk vid handel med finansiella instrument, prospektförordningen och lagen (2006:451) om offentliga uppköpserbjudanden på aktiemarknaden följs, får Finansinspektionen begära att

För övervakningen av att bestämmelserna i denna lag, lagen (2000:1087) om anmälningsskyldighet för vissa innehav av finansiella instrument, lagen (2005:377) om straff för marknadsmissbruk vid handel med finansiella instrument, prospektförordningen och lagen (2006:451) om offentliga uppköpserbjudanden på aktiemarknaden följs, får Finansinspektionen begära att

1. ett företag eller någon annan tillhandahåller uppgifter, handlingar eller annat,

2. den som förväntas kunna lämna upplysningar i saken inställer sig till förhör på tid och plats som inspektionen bestämmer.

Första stycket gäller inte i den utsträckning en sådan begäran skulle strida mot den i lag reglerade tystnadsplikten för advokater.

Första stycket gäller inte i den utsträckning uppgiftslämnandet skulle strida mot den i lag reglerade tystnadsplikten för advokater.

Vid tillämpningen av 2, 2 b och 4 kap. denna lag samt 5 a kap. och 9 a kap. lagen om börs- och clearingverksamhet gäller inte första stycket 2.

Vid tillämpningen av 2, 2 b och 4 kap. gäller inte första stycket 2.

135

1 b §

En emittent vars finansiella instrument har tagits upp till handel på en reglerad marknad och vars hemmedlemsstat är Sverige skall varje år sammanställa ett dokument som innehåller eller hänvisar till all den information som emittenten till följd av upptagandet har offentliggjort under de senaste tolv månaderna. Om det i dokumentet hänvisas till information i ett annat dokument, skall det anges var det dokumentet finns att få.

En emittent vars överlåtbara värdepapper har tagits upp till handel på en reglerad marknad och vars hemmedlemsstat är Sverige skall varje år sammanställa ett dokument som innehåller eller hänvisar till all den information som emittenten till följd av upptagandet har offentliggjort under de senaste tolv månaderna. Om det i dokumentet hänvisas till information i ett annat dokument, skall det anges var det dokumentet finns att få.

Regeringen eller den myndighet som regeringen bestämmer meddelar föreskrifter om vilken information dokumentet skall innehålla.

Bestämmelser om offentliggörandet av dokumentet finns i prospektförordningen. Dokumentet skall ges in till Finansinspektionen inom den tid som anges i artikel 27 i förordningen.

Skyldighet att upprätta ett dokument enligt första stycket skall inte gälla i fråga om

1. sådana finansiella instrument som avses i 2 kap. 2 §, och

2. icke aktierelaterade finansiella instrument som vart och ett har ett nominellt värde som motsvarar minst 50 000 euro.

Skyldighet att upprätta ett dokument enligt första stycket skall inte heller gälla i fråga om sådana finansiella instrument som avses i 2 kap. 3 §, om inte bestämmelserna i denna lag och prospektförordningen har blivit tillämpliga enligt 2 kap. 8 §.

Skyldighet att upprätta ett dokument enligt första stycket skall inte gälla i fråga om

1. sådana överlåtbara värdepapper som avses i 2 kap. 2 §, och

2. icke aktierelaterade överlåtbara värdepapper som vart och ett har ett nominellt värde som motsvarar minst 50 000 euro.

Skyldighet att upprätta ett dokument enligt första stycket skall inte heller gälla i fråga om sådana överlåtbara värdepapper som avses i 2 kap. 3 §, om inte bestämmelserna i denna lag och prospektförordningen har blivit tillämpliga enligt 2 kap. 8 §.

Nuvarande lydelse Föreslagen lydelse

1 c §

TPF

48

FPT

Finansinspektionen får tillfälligt förbjuda ett erbjudande av finansiella instrument till allmänheten, ett upptagande av finansiella instrument till handel på en reglerad marknad eller ett offentligt uppköpserbjudande, om inspektionen har skälig anledning

Finansinspektionen får tillfälligt förbjuda ett erbjudande av överlåtbara värdepapper till allmänheten, ett upptagande av överlåtbara värdepapper till handel på en reglerad marknad eller ett offentligt uppköpserbjudande, om inspektionen har skälig anledning

TP

48

PT

Senaste lydelse 2006:454.

136

att anta att erbjudandet, upptagandet till handel eller uppköpserbjudandet strider mot bestämmelserna i denna lag eller prospektförordningen. Ett sådant förbud får gälla under högst tio arbetsdagar.

att anta att erbjudandet, upptagandet till handel eller uppköpserbjudandet strider mot bestämmelserna i denna lag eller prospektförordningen. Ett sådant förbud får gälla under högst tio arbetsdagar.

Finansinspektionen får permanent förbjuda ett erbjudande av finansiella instrument till allmänheten, om inspektionen finner att bestämmelserna i denna lag eller prospektförordningen har överträtts.

Finansinspektionen får permanent förbjuda ett erbjudande av överlåtbara värdepapper till allmänheten, om inspektionen finner att bestämmelserna i denna lag eller prospektförordningen har överträtts.

Finansinspektionen får permanent förbjuda ett offentligt uppköpserbjudande, om inspektionen finner att bestämmelserna i lagen (2006:451) om offentliga uppköpserbjudanden på aktiemarknaden har överträtts.

1 d §

TPF

49

FPT

Finansinspektionen får förbjuda reklam som avser ett erbjudande av finansiella instrument till allmänheten, ett upptagande av finansiella instrument till handel på en reglerad marknad eller ett offentligt uppköpserbjudande, om inspektionen har skälig anledning att anta att erbjudandet, upptagandet eller uppköpserbjudandet strider mot bestämmelserna i denna lag eller prospektförordningen. Om förbudet är tillfälligt, får det gälla under högst tio arbetsdagar.

Finansinspektionen får förbjuda reklam som avser ett erbjudande av överlåtbara värdepapper till allmänheten, ett upptagande av överlåtbara värdepapper till handel på en reglerad marknad eller ett offentligt uppköpserbjudande, om inspektionen har skälig anledning att anta att erbjudandet, upptagandet eller uppköpserbjudandet strider mot bestämmelserna i denna lag eller prospektförordningen. Om förbudet är tillfälligt, får det gälla under högst tio arbetsdagar.

Lydelse enligt prop. 2006/07:65 Föreslagen lydelse

1 e §

När ett prospekt är giltigt i Sverige enligt 2 kap. 36 §, skall Finansinspektionen underrätta den myndighet som har godkänt prospektet, om emittenten eller ett utländskt värdepappersföretag som medverkar vid ett erbjudande av finansiella instrument till allmänheten har gjort sig skyldig till ekonomisk brottslighet eller har

När ett prospekt är giltigt i Sverige enligt 2 kap. 36 §, skall Finansinspektionen underrätta den myndighet som har godkänt prospektet, om emittenten eller ett utländskt värdepappersföretag som medverkar vid ett erbjudande av överlåtbara värdepapper till allmänheten har gjort sig skyldig till ekonomisk brottslighet eller har

TP

49

PT

Senaste lydelse 2005:833.

137

överträtt bestämmelserna i 6 kap. 1 b § denna lag eller lagen (1992:543) om börs- och clearingverksamhet.

överträtt bestämmelserna i 6 kap. 1 b § denna lag eller 15–18 kap. lagen (2007:000) om värdepappersmarknaden.

Om emittenten eller det utländska värdepappersföretaget, trots de åtgärder som vidtagits av den myndighet som godkänt prospektet, fortsätter brottsligheten eller överträdelsen, får Finansinspektionen vidta åtgärd enligt 1 c och 1 d §§. Innan åtgärd vidtas skall inspektionen underrätta den myndighet som har godkänt prospektet. Finansinspektionen skall också underrätta Europeiska gemenskapernas kommission så snart som möjligt.

Nuvarande lydelse Föreslagen lydelse

1 f §

TPF

50

FPT

När Finansinspektionen har godkänt ett prospekt, får inspektionen, om behörig myndighet i en annan stat inom EES underrättat inspektionen om att emittenten eller ett värdepappersinstitut, som medverkar vid ett erbjudande av finansiella instrument till allmänheten i den staten, har överträtt föreskrifter som gäller i den staten eller inte fullgjort sina skyldigheter när finansiella instrument tagits upp till handel på en reglerad marknad, vidta åtgärd enligt 1 c och 1 d §§ mot emittenten eller institutet.

När Finansinspektionen har godkänt ett prospekt, får inspektionen, om behörig myndighet i en annan stat inom EES underrättat inspektionen om att emittenten eller ett värdepappersinstitut, som medverkar vid ett erbjudande av överlåtbara värdepapper till allmänheten i den staten, har överträtt föreskrifter som gäller i den staten eller inte fullgjort sina skyldigheter när överlåtbara värdepapper tagits upp till handel på en reglerad marknad, vidta åtgärd enligt 1 c och 1 d §§ mot emittenten eller institutet.

Lydelse enligt prop. 2006/07:65 Föreslagen lydelse

1 g §

Bestämmelserna i 1 h § skall tillämpas om aktier eller sådana depåbevis eller finansiella instrument som avses i 4 kap. 2 § första stycket är noterade vid en börs eller en auktoriserad marknadsplats och aktierna har getts ut av ett bolag som

Bestämmelserna i 1 h § skall tillämpas om aktier eller sådana depåbevis eller finansiella instrument som avses i 4 kap. 2 § första stycket är upptagna till handel på en reglerad marknad i Sverige och aktierna har getts ut av ett bolag som

1. har sitt säte i en annan stat inom EES, eller

2. inte har säte i en stat inom EES och inte omfattas av 4 kap. 22 §. I 11 a kap. 13 § lagen (1992:543) om börs- och clearingverksamhet finns bestämmelser om ingripande mot sådana bolag

I 25 kap. 24 § lagen (2007:000) om värdepappersmarknaden finns bestämmelser om ingripande mot sådana bolag som avses i första

TP

50

PT

Senaste lydelse 2005:833.

138

som avses i första stycket. stycket.

7 kap.

1 §

Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om

1. villkor för sådana avtal som avses i 3 kap. 1 och 3 §§,

2. på vilket språk sådan information som avses i 4 kap. 1 § tredje stycket eller 20 § skall offentliggöras,

3. vilka upplysningar marknadsgaranter som inte är värdepappersinstitut och som har utnyttjat undantaget i 4 kap. 14 § första stycket skall lämna till Finansinspektionen,

4. vad som krävs för att undantag från sammanläggning av moder- och dotterföretags innehav skall få göras enligt 4 kap. 16 och 17 §§,

5. att sådana anmälningar som enligt 4 kap. 19 § görs till Finansinspektionen i stället skall göras till en börs eller auktoriserad marknadsplats där aktierna är noterade och i vilken omfattning och på vilket sätt uppgifter om förvärv eller överlåtelse av egna aktier skall offentliggöras samt hur skyldigheten att anmäla förvärv och överlåtelser till Finansinspektionen skall fullgöras,

5. att sådana anmälningar som enligt 4 kap. 19 § görs till Finansinspektionen i stället skall göras till den börs som driver den reglerade marknad där aktierna är upptagna till handel och i vilken omfattning och på vilket sätt uppgifter om förvärv eller överlåtelse av egna aktier skall offentliggöras samt hur skyldigheten att anmäla förvärv och överlåtelser till Finansinspektionen skall fullgöras,

6. hur information skall offentliggöras enligt 4 kap. 20 §,

7. information enligt 5 a kap. 1 och 2 §§, och

8. hur uppgiftsskyldigheten i 6 kap. 1 a § första stycket skall fullgöras.

U

Denna lag träder i kraft den 1 november 2007.

139

2.9 Förslag till lag om ändring i lagen (1992:160) om utländska filialer m.m.

Härigenom föreskrivs att 3 § lagen (1992:160) om utländska filialer m.m. skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

3 §

TPF

1

FPT

Om rätt för vissa utländska företag att driva verksamhet i Sverige finns särskilda bestämmelser, nämligen

1. för kreditinstitut 4 kap.1, 2 och 46 §§ lagen (2004:297) om bank- och finansieringsrörelse,

2. för värdepappersföretag 1 kap. 3 c § och 2 kap. 7 § lagen (1991:981) om värdepappersrörelse,

2. för värdepappersföretag 4 kap.1 och 4 §§ lagen (2007:000) om värdepappersmarknaden,

3. för finansiella institut 4 kap. 3 § lagen om bank- och finansieringsrörelse,

4. för utländska försäkringsgivare lagen (1998:293) om utländska försäkringsgivares och tjänstepensionsinstituts verksamhet i Sverige,

5. för börser, auktoriserade marknadsplatser och clearingorganisationer 2 kap. 7 §, 7 kap. 2 § respektive 8 kap. 3 § lagen (1992:543) om börs- och clearingverksamhet,

5. för börser och clearingorganisationer 12 kap. 9 § och 19 kap. 12 § lagen om värdepappersmarknaden,

6. för centrala värdepappersförvarare 2 kap. 6 § lagen (1998:1479) om kontoföring av finansiella instrument,

7. för förvaltningsbolag och fondföretag 1 kap.611 §§ lagen (2004:46) om investeringsfonder,

8. för utgivare av elektroniska pengar 2 kap. 8 § samt 5 kap.6 och 7 §§ lagen (2002:149) om utgivning av elektroniska pengar,

9. för företag som driver inlåningsverksamhet 2 § lagen (2004:299) om inlåningsverksamhet, och

10. för utländska försäkringsförmedlare 3 kap. lagen (2005:405) om försäkringsförmedling.

U

Denna lag träder i kraft den 1 november 2007.

TP

1

PT

Senaste lydelse 2005:1128.

140

2.10 Förslag till lag om ändring i konkurrenslagen (1993:20)

Härigenom föreskrivs att 35 § konkurrenslagen (1993:20) skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

35 §

TPF

1

FPT

Ett förbud mot en företagskoncentration innebär att en rättshandling som utgör en del i företagskoncentrationen därefter blir ogiltig. Detta gäller dock inte sådana rättshandlingar som utgörs av förvärv som har skett på en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad eller genom inrop på exekutiv auktion. I sådana fall får förvärvaren i stället åläggas att avyttra det som har förvärvats.

Ett förbud mot en företagskoncentration innebär att en rättshandling som utgör en del i företagskoncentrationen därefter blir ogiltig. Detta gäller dock inte sådana rättshandlingar som utgörs av förvärv som har skett på en reglerad marknad som avses i 1 kap. 5 § 20 lagen (2007:000) om värdepappersmarknaden, en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet eller en handelsplattform som avses i 1 kap. 5 § 12 lagen om värdepappersmarknaden eller genom inrop på exekutiv auktion. I sådana fall får förvärvaren i stället åläggas att avyttra det som har förvärvats.

U

1. Denna lag träder i kraft den 1 november 2007.

2. I fråga om förvärv som har skett före ikraftträdandet gäller äldre bestämmelser.

TP

1

PT

Senaste lydelse 2000:88.

141

2.11 Förslag till lag om ändring i lagen (1993:768) om åtgärder mot penningtvätt

Härigenom föreskrivs att 2 § lagen (1993:768) om åtgärder mot penningtvätt

TPF

1

FPT

skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

2 §

TPF

2

FPT

Bestämmelserna i denna lag gäller fysiska och juridiska personer som driver

1. bank- eller finansieringsrörelse enligt lagen (2004:297) om bank- och finansieringsrörelse,

2. livförsäkringsrörelse,

3. verksamhet av det slag som beskrivs i 1 kap. 3 § lagen (1991:981) om värdepappersrörelse,

3. verksamhet av det slag som beskrivs i 2 kap. 1 § lagen (2007:000) om värdepappersmarknaden,

4. verksamhet som kräver anmälan till eller ansökan hos Finansinspektionen enligt lagen (1996:1006) om anmälningsplikt avseende viss finansiell verksamhet eller lagen (2004:299) om inlåningsverksamhet,

5. försäkringsförmedling enligt lagen (2005:405) om försäkringsförmedling,

6. verksamhet för utgivning av elektroniska pengar enligt lagen (2002:149) om utgivning av elektroniska pengar,

7. fondverksamhet enligt lagen (2004:46) om investeringsfonder,

8. verksamhet som fastighetsmäklare enligt fastighetsmäklarlagen (1995:400),

9. verksamhet för kasinospel enligt kasinolagen (1999:355), 10. verksamhet som godkänd eller auktoriserad revisor, eller 11. yrkesmässig verksamhet som består i att lämna råd i avsikt att påverka storleken på en skatt eller avgift (skatterådgivare).

Lagen gäller endast sådan mot kunder inriktad verksamhet som avses i första stycket. I fråga om verksamheter som avses i första stycket 1–7 gäller lagen även filialer i Sverige till utländska juridiska personer med huvudkontor i utlandet.

Bestämmelser om uppgiftsskyldighet för vissa andra fysiska och juridiska personer finns i 9 c §.

U

Denna lag träder i kraft den 1 november 2007.

TP

1

PT

Lagen omtryckt 1999:162.

TP

2

PT

Senaste lydelse 2006:535.

142

2.12 Förslag till lag om ändring i lagen (1993:931) om individuellt pensionssparande

Härigenom föreskrivs att 1 kap. 2 §, 2 kap. 4 § samt 7 kap.2 och 5 §§ lagen (1993:931) om individuellt pensionssparande skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

1 kap.

2 §

I denna lag betyder

1. pensionssparavtal: sådant avtal som anges i 1 §,

2. pensionssparrörelse: verksamhet som består i att erbjuda allmänheten pensionssparavtal,

3. pensionssparinstitut: företag som har fått tillstånd att driva pensionssparrörelse,

4. pensionssparare: en person som ingått pensionssparavtal,

5. pensionssparkonto: sådant konto som avses i 3 kap. 4 §,

6. kontoinnehavare: pensionssparare och person som genom förmånstagarförordnande eller bodelning förvärvat rätt enligt ett pensionssparavtal,

7.

U

värdepappersinstitut

U

: vad

som anges i 1 kap. 2 § 5 lagen (1991:981) om värdepappersrörelse,

7.

U

värdepappersinstitut

U

: det som

anges i 1 kap. 5 § 27 lagen (2007:000) om värdepappersmarknaden, och

8.

U

fondpapper:

U

vad som anges i

1 kap. 1 § lagen (1991:980) om handel med finansiella instrument.

8.

U

fondpapper

U

: aktie och obliga-

tion samt sådana andra delägarrätter eller fordringsrätter som är utgivna för allmän omsättning, fondandel och aktieägares rätt gentemot den som för hans räkning förvarar aktiebrev i ett utländskt bolag (depåbevis).

2 kap.

4 §

TPF

1

FPT

Vid sparande i andra fondpapper än andelar i en investeringsfond skall pensionssparmedlen för spararens räkning placeras i fondpapper som är noterade vid en börs eller auktoriserad marknadsplats eller som i utlandet är föremål för handel vid en reglerad marknad som är öppen för allmänheten.

Vid sparande i andra fondpapper än andelar i en investeringsfond skall pensionssparmedlen för spararens räkning placeras i fondpapper som är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet.

TP

1

PT

Senaste lydelse 2004:60.

143

7 kap.

2 §

TPF

2

FPT

Bestämmelserna i 6 kap. 2, 7, 9– 10 och 12 §§ samt i 7 kap. 1 § lagen (1991:981) om värdepappersrörelse skall tillämpas även i fråga om pensionssparrörelse. Hänvisningarna till lagen om värdepappersrörelse skall därvid i stället gälla denna lag.

Bestämmelserna i 23 kap. 15 § 1, 25 kap.1, 2, 46, 17 och 29 §§ samt 26 kap. 1 § lagen (2007:000) om värdepappersmarknaden skall tillämpas även i fråga om pensionssparrörelse. Hänvisningarna till lagen om värdepappersmarknaden skall därvid i stället gälla denna lag.

5 §

TPF

3

FPT

Beslut som Finansinspektionen meddelar med stöd av 1 kap. 4 § samt 6 kap. 2 § och 4 § första stycket får överklagas hos kammarrätten.

Finansinspektionens beslut enligt denna lag får, med undantag av det som följer av hänvisningen i 2 § till 26 kap. 1 § lagen (2007:000) om värdepappersmarknaden, överklagas hos allmän förvaltningsdomstol. Detta gäller dock inte beslut som avses i 20 § första stycket 5 förvaltningslagen (1986:223).

Andra beslut som inspektionen meddelar får, med undantag av vad som följer av hänvisningen i 2 § till bestämmelser i lagen (1991:981) om värdepappersrörelse, överklagas hos länsrätten. Prövningstillstånd krävs vid överklagande till kammarrätten.

Prövningstillstånd krävs vid överklagande till kammarrätten.

U

Denna lag träder i kraft den 1 november 2007.

TP

2

PT

Senaste lydelse 1994:2019.

TP

3

PT

Senaste lydelse 1998:389.

144

2.13 Förslag till lag om ändring i pantbankslagen (1995:1000)

Härigenom föreskrivs att 17 § pantbankslagen (1995:1000) skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

17 §

Försäljning skall ske på offentlig auktion på den ort där pantsättningen ägt rum, om inte låntagaren eller den som förvärvat rätten till panten medger att försäljning sker på annan ort.

Om panten utgörs av värdepapper som är noterade på svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad, skall försäljningen dock ske genom ett värdepappersinstitut och till gällande börs- eller marknadspris.

Om panten utgörs av finansiella instrument som är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet, skall försäljningen dock ske genom ett värdepappersinstitut och till gällande marknadspris.

U

Denna lag träder i kraft den 1 november 2007.

145

2.14 Förslag till lag om ändring i årsredovisningslagen (1995:1554)

Härigenom föreskrivs i fråga om årsredovisningslagen (1995:1554) dels att 1 kap. 3 §, 3 kap. 4 a §, 6 kap. 1 a och 2 a §§, 7 kap. 2 och 3 §§ samt 9 kap. 1 och 2 §§ skall ha följande lydelse,

dels att punkten 2 i ikraftträdande- och övergångsbestämmelserna till lagen (2007:000) om ändring i nämnda lag skall ha följande lydelse.

Lydelse enligt SFS 2007:132 Föreslagen lydelse

1 kap.

3 §

I denna lag betyder 1.

U

företag

U

: en fysisk eller juridisk person som direkt eller indirekt

omfattas av en årsredovisning, en koncernredovisning eller en delårsrapport,

2.

U

andelar

U

: aktier och andra andelar i juridiska personer,

3.

U

nettoomsättning

U

: intäkter från sålda varor och utförda tjänster som

ingår i företagets normala verksamhet med avdrag för lämnade rabatter, mervärdesskatt och annan skatt som är direkt knuten till omsättningen,

4.

U

större företag

U

:

– företag vars andelar, teckningsoptioner eller skuldebrev är noterade vid en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad eller

– företag vars andelar, teckningsoptioner eller skuldebrev är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet eller

– företag som uppfyller mer än ett av följande villkor:

a) medelantalet anställda i företaget har under vart och ett av de två senaste räkenskapsåren uppgått till mer än 50,

b) företagets redovisade balansomslutning har för vart och ett av de två senaste räkenskapsåren uppgått till mer än 25 miljoner kronor,

c) företagets redovisade nettoomsättning har för vart och ett av de två senaste räkenskapsåren uppgått till mer än 50 miljoner kronor,

5.

U

mindre företag

U

: företag som inte är större företag,

6.

U

större koncerner

U

: koncerner som uppfyller mer än ett av följande

villkor:

a) medelantalet anställda i koncernen har under vart och ett av de två senaste räkenskapsåren uppgått till mer än 50,

b) koncernföretagens redovisade balansomslutning har för vart och ett av de två senaste räkenskapsåren uppgått till mer än 25 miljoner kronor,

c) koncernföretagens redovisade nettoomsättning har för vart och ett av de två senaste räkenskapsåren uppgått till mer än 50 miljoner kronor,

7.

U

mindre koncerner

U

: koncerner som inte är större koncerner.

Vid tillämpningen av första stycket 6 b och c skall fordringar och skulder mellan koncernföretag, liksom internvinster, elimineras. Detsamma gäller för intäkter och kostnader som hänför sig till transaktioner mellan koncernföretag, liksom förändring av internvinst.

146

Företag som avses i 2 kap. 2 § första stycket och 3 §bokföringslagen (1999:1078) skall vid tillämpningen av första stycket 4–7 och 5 kap. 6 § till nettoomsättningen lägga bidrag, gåvor, medlemsavgifter och andra liknande intäkter.

Nuvarande lydelse Föreslagen lydelse

3 kap.

4 a §

TPF

1

FPT

Trots bestämmelserna i 3 och 4 §§ får företag som avses i andra stycket dela upp anläggningstillgångar och omsättningstillgångar samt skulder och avsättningar i kortfristiga och långfristiga poster, om det är förenligt med 2 kap. 2 och 3 §§.

Bestämmelserna i första stycket gäller

1. företag som omfattas av en koncernredovisning som upprättas med tillämpning av de internationella redovisningsstandarder som avses i Europaparlamentets och rådets förordning (EG) nr 1606/2002 av den 19 juli 2002 om tillämpning av internationella redovisningsstandarder

TPF

2

FPT

, och

2. andra företag vars andelar eller skuldebrev är noterade vid en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad inom det Europeiska ekonomiska samarbetsområdet.

2. andra företag vars andelar eller skuldebrev är upptagna till handel på en reglerad marknad.

6 kap.

1 a §

TPF

3

FPT

I ett aktiebolag, vars aktier är noterade vid en börs eller en auktoriserad marknadsplats, skall förvaltningsberättelsen även innehålla

I ett aktiebolag, vars aktier är upptagna till handel på en reglerad marknad i Sverige, skall förvaltningsberättelsen även innehålla

1. de senast beslutade riktlinjerna av det slag som avses i 8 kap. 51 § aktiebolagslagen (2005:551), och

2. styrelsens förslag till riktlinjer att gälla för tiden från nästa årsstämma.

Information enligt första stycket 1 får lämnas i anslutning till uppgifter som lämnas enligt 5 kap. 20 eller 22 §. I sådant fall skall förvaltningsberättelsen innehålla en hänvisning till den plats där informationen har lämnats.

2 a §

TPF

4

FPT

I ett aktiebolag vars aktier är noterade vid en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad skall det i förvaltningsberättelsen

I ett aktiebolag vars aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet skall

TP

1

PT

Senaste lydelse 2004:1173.

TP

2

PT

EGT L 243, 11.9.2002, s. 1 (Celex 32002R1606).

TP

3

PT

Senaste lydelse 2006:565.

TP

4

PT

Senaste lydelse 2006:456.

147

även lämnas upplysningar om det i förvaltningsberättelsen även lämnas upplysningar om

1. det totala antalet aktier i bolaget, antalet aktier av olika slag och, för varje aktieslag, vilka rättigheter aktierna ger i bolaget,

2. begränsningar i aktiernas överlåtbarhet på grund av bestämmelse i lag eller bolagsordning,

3. direkta eller indirekta aktieinnehav i bolaget, som representerar minst en tiondel av röstetalet för samtliga aktier i bolaget,

4. anställdas aktieinnehav i bolaget genom pensionsstiftelser eller liknande, om rösträtten för dessa aktier inte kan utövas direkt av de anställda,

5. begränsningar i fråga om hur många röster varje aktieägare kan avge vid en bolagsstämma,

6. av bolaget kända avtal mellan aktieägare som kan medföra begränsningar i rätten att överlåta aktierna,

7. bestämmelser i bolagsordningen om tillsättande och entledigande av styrelseledamöter samt om ändring av bolagsordningen,

8. av bolagsstämman lämnade bemyndiganden till styrelsen att besluta att bolaget skall ge ut nya aktier eller förvärva egna aktier,

9. väsentliga avtal som bolaget är part i och som får verkan eller ändras eller upphör att gälla om kontrollen över bolaget förändras som följd av ett offentligt uppköpserbjudande,

10. effekter av avtal som avses i punkt 9, dock inte när avtalen är av sådan art att ett offentliggörande sannolikt skulle skada bolaget allvarligt och bolaget inte uttryckligen är skyldigt att lämna ut sådana uppgifter på grund av andra rättsliga krav, och

11. sådana avtal mellan bolaget och styrelseledamöter eller anställda som föreskriver ersättningar om dessa säger upp sig, sägs upp utan skälig grund eller om deras anställning upphör som följd av ett offentligt uppköpserbjudande avseende aktier i bolaget.

7 kap.

2 §

TPF

5

FPT

Ett moderföretag som är dotterföretag behöver inte upprätta koncernredovisning, om

1. företaget och dess samtliga dotterföretag omfattas av en koncernredovisning som upprättas av ett överordnat moderföretag, och

2. det överordnade moderföretagets koncernredovisning har upprättats och reviderats enligt lagstiftning som har tillkommit i enlighet med Europeiska gemenskapernas direktiv av den 13 juni 1983 om sammanställd redovisning (83/349/EEG) eller på likvärdigt sätt.

Första stycket gäller även om något dotterföretag av skäl som anges i 5 § andra eller tredje stycket inte omfattas av den upprättade koncernredovisningen.

Ett moderföretag som med stöd av första stycket inte självt har upprättat någon koncernredovisning skall ge in det överordnade moderföretagets koncernredovisning och koncernrevisionsberättelse till registreringsmyndigheten enligt bestämmelserna i 8 kap. 3–3 b §§. Registreringsmyndigheten skall på det sätt som anges i 8 kap. 4 §

TP

5

PT

Senaste lydelse 2006:871.

148

kungöra att handlingarna har getts in. Om handlingarna inte är avfattade på svenska, får registreringsmyndigheten förelägga moderföretaget att ge in en bestyrkt översättning till svenska. Sådant föreläggande skall utfärdas om någon begär det. Om moderföretaget, i fall det hade upprättat en koncernredovisning, enligt 8 kap. 3 och 16 §§ inte skulle ha varit skyldigt att ge in denna och koncernrevisionsberättelsen till registreringsmyndigheten, skall vad som i nämnda paragrafer sägs om att handlingarna skall hållas tillgängliga i stället tillämpas på det överordnade moderföretagets koncernredovisning och koncernrevisionsberättelse.

Första stycket gäller inte,

1. om delägare som har en kapitalandel i moderföretaget på minst tio procent senast sex månader före räkenskapsårets utgång hos moderföretagets styrelse eller motsvarande ledningsorgan har krävt att koncernredovisning skall upprättas, eller

2. om andelarna i moderföretaget eller skuldebrev som moderföretaget har utfärdat är noterade vid en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad inom det Europeiska ekonomiska samarbetsområdet.

2. om andelarna i moderföretaget eller skuldebrev som moderföretaget har utfärdat är upptagna till handel på en reglerad marknad.

Den som enligt första stycket inte upprättar någon koncernredovisning skall upplysa om detta i en not till årsredovisningen samt lämna uppgift om namn, organisationsnummer eller, i förekommande fall, personnummer samt säte för det överordnade moderföretag som upprättar den i stycket nämnda koncernredovisningen.

3 §

TPF

6

FPT

Moderföretag i mindre koncerner behöver inte upprätta koncernredovisning.

Första stycket gäller inte om andelar i moderföretaget eller något av dotterföretagen eller skuldebrev som moderföretaget eller något av dotterföretagen har utfärdat är noterade vid en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad inom Europeiska ekonomiska samarbetsområdet.

Första stycket gäller inte om andelar i moderföretaget eller något av dotterföretagen eller skuldebrev som moderföretaget eller något av dotterföretagen har utfärdat är upptagna till handel på en reglerad marknad.

Lydelse enligt prop. 2006/07:65 Föreslagen lydelse

9 kap.

1 §

Ett företag som enligt 1 kap. 1 § andra stycket lagen (1995:1559) om årsredovisning i kreditinstitut och värdepappersbolag eller 1 kap. 1 §

TP

6

PT

Senaste lydelse 2006:871.

149

andra stycket lagen (1995:1560) om årsredovisning i försäkringsföretag är skyldigt att upprätta koncernredovisning, skall minst en gång under ett räkenskapsår som omfattar mer än tio månader lämna en särskild redovisning (delårsrapport).

Delårsrapporten skall upprättas för en period mellan räkenskapsårets början och delårsperiodens utgång. Minst en delårsrapport skall, om inte annat följer av 5 a kap. 5 § lagen (1992:543) om börs- och clearingverksamhet, omfatta en period av minst hälften och högst två tredjedelar av räkenskapsåret. I 5 a kap. lagen om börs- och clearingverksamhet finns ytterligare bestämmelser om vilka företag som skall lämna delårsrapport.

Delårsrapporten skall upprättas för en period mellan räkenskapsårets början och delårsperiodens utgång. Minst en delårsrapport skall, om inte något annat följer av 16 kap. 6 § lagen (2007:000) om värdepappersmarknaden, omfatta en period av minst hälften och högst två tredjedelar av räkenskapsåret. I 16 kap. lagen om värdepappersmarknaden finns ytterligare bestämmelser om vilka företag som skall lämna delårsrapport.

Delårsrapporten skall avfattas på svenska i vanlig läsbar form. I aktiebolag får den i stället upprättas i elektronisk form.

2 §

Delårsrapporten skall hållas tillgänglig hos företaget för var och en som vill ta del av den. En kopia skall genast sändas till en sådan aktieägare, bolagsman eller medlem som begär det och uppger sin postadress. En delårsrapport som avses i 1 § andra stycket andra meningen och en delårsrapport som avses i 5 a kap. 5 § lagen (1992:543) om börs- och clearingverksamhet skall senast två månader efter rapportperiodens utgång lämnas till registreringsmyndigheten i enlighet med bestämmelserna i 8 kap. 3–3 b §§.

Delårsrapporten skall hållas tillgänglig hos företaget för var och en som vill ta del av den. En kopia skall genast sändas till en sådan aktieägare, bolagsman eller medlem som begär det och uppger sin postadress. En delårsrapport som avses i 1 § andra stycket andra meningen och en delårsrapport som avses i 16 kap. 6 § lagen (2007:000) om värdepappersmarknaden skall senast två månader efter rapportperiodens utgång lämnas till registreringsmyndigheten i enlighet med bestämmelserna i 8 kap. 3–3 b §§.

Om delårsrapporten inte lämnas till registreringsmyndigheten i rätt tid, tillämpas 8 kap. 13 §.

Ytterligare bestämmelser om offentliggörande av delårsrapporter finns i 9 a kap. lagen om börs- och clearingverksamhet, för sådana företag som är skyldiga att upprätta delårsrapport enligt den lagen.

Ytterligare bestämmelser om offentliggörande av delårsrapporter finns i 17 kap. lagen om värdepappersmarknaden, för sådana företag som är skyldiga att upprätta delårsrapport enligt den lagen.

U

2. Företag som inte omfattas av 2. Företag som inte omfattas av

150

5 a kap. 5 § lagen (1992:543) om börs- och clearingverksamhet får tillämpa äldre bestämmelser i 9 kap. 3 § om delårsrapporters innehåll m.m. för räkenskapsår som avslutas senast den 30 juni 2008. Sådana företag behöver inte heller tillämpa 9 kap. 6 § om revisors granskning för nämnda räkenskapsår.

16 kap. 5 § lagen (2007:000) om värdepappersmarknaden får tilllämpa bestämmelserna i 9 kap. 3 § om delårsrapporters innehåll m.m. i deras lydelse före den 1 juli 2007 för räkenskapsår som avslutas senast den 30 juni 2008. Sådana företag behöver inte heller tillämpa 9 kap. 6 § om revisors granskning för nämnda räkenskapsår.

U

Denna lag träder i kraft den 1 november 2007.

151

2.15 Förslag till lag om ändring i lagen (1995:1559) om årsredovisning i kreditinstitut och värdepappersbolag

Härigenom föreskrivs i fråga om lagen (1995:1559) om årsredovisning i kreditinstitut och värdepappersbolag

dels att 1 kap. 1 §, 3 kap. 1 § och 6 kap. 1 § skall ha följande lydelse, dels att punkten 2 i ikraftträdande- och övergångsbestämmelserna till lagen (2007:000) om ändring i nämnda lag skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

1 kap.

1 §

TPF

1

FPT

Denna lag är tillämplig på kreditinstitut och värdepappersbolag. Med kreditinstitut avses bankaktiebolag, sparbanker, medlemsbanker, kreditmarknadsföretag (kreditmarknadsbolag respektive kreditmarknadsföreningar), institut för elektroniska pengar, Sveriges allmänna hypoteksbank och Svenska skeppshypotekskassan. Med värdepappersbolag avses ett svenskt aktiebolag som fått tillstånd att driva värdepappersrörelse enligt lagen (1991:981) om värdepappersrörelse.

Denna lag är tillämplig på kreditinstitut och värdepappersbolag. Med kreditinstitut avses bankaktiebolag, sparbanker, medlemsbanker, kreditmarknadsföretag (kreditmarknadsbolag respektive kreditmarknadsföreningar), institut för elektroniska pengar, Sveriges allmänna hypoteksbank och Svenska skeppshypotekskassan. Med värdepappersbolag avses det som sägs i 1 kap. 5 § 26 lagen (2007:000) om värdepappersmarknaden.

Bestämmelserna om koncernredovisning i 7 kap. skall tillämpas på finansiella holdingföretag som uteslutande eller huvudsakligen förvaltar andelar i dotterföretag som är kreditinstitut eller värdepappersbolag eller utländska företag av motsvarande slag. Med finansiellt holdingföretag avses ett aktiebolag, ett handelsbolag eller en ekonomisk förening vars verksamhet uteslutande eller så gott som uteslutande består i att i vinstsyfte förvärva och förvalta andelar i dotterföretag.

3 kap.

1 §

TPF

2

FPT

Balansräkningen skall upprättas enligt den uppställningsform som anges i bilaga 1 till denna lag. Resultaträkningen skall upprättas enligt den uppställningsform som anges i bilaga 2. Hänvisningar i denna lag till poster gäller poster i dessa uppställningsformer, om inte annat framgår.

Trots bestämmelserna i första stycket samt 2 och 3 §§ får kreditinstitut och värdepappersbolag som avses i tredje stycket dela upp posterna med hänsyn till deras karaktär och relativa likviditet, om det är förenligt med 2 kap.2 och 3 §§årsredovisningslagen (1995:1554).

Bestämmelserna i andra stycket gäller

TP

1

PT

Senaste lydelse 2004:434.

TP

2

PT

Senaste lydelse 2004:1175.

152

1. företag som omfattas av en koncernredovisning som upprättas med tillämpning av de internationella redovisningsstandarder som avses i Europaparlamentets och rådets förordning (EG) nr 1606/2002 av den 19 juli 2002 om tillämpning av internationella redovisningsstandarder

TPF

3

FPT

, och

2. andra företag vars aktier eller skuldebrev är noterade vid en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad inom det Europeiska ekonomiska samarbetsområdet.

2. andra företag vars aktier eller skuldebrev är upptagna till handel på en reglerad marknad.

Regeringen eller, efter regeringens bemyndigande, Finansinspektionen får meddela föreskrifter om avvikande uppställningsformer för balansräkningen och resultaträkningen för värdepappersbolag, om avvikelserna är nödvändiga med hänsyn till dessa bolags särskilda verksamhetsinriktning.

6 kap.

1 §

TPF

4

FPT

Följande bestämmelser i 6 kap. årsredovisningslagen (1995:1554) skall tillämpas:

1 § första–fjärde styckena om förvaltningsberättelsens innehåll,

2 § om förslag till dispositioner av vinst eller förlust m.m., 2 a § om vissa upplysningar i förvaltningsberättelsen i aktiebolag vars aktier är noterade vid en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad,

2 a § om vissa upplysningar i förvaltningsberättelsen i aktiebolag vars aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet,

3 § första stycket om vissa upplysningar om ekonomiska föreningar, samt

5 § om finansieringsanalys. Bankaktiebolag, kreditmarknadsbolag och värdepappersbolag, vars aktier är noterade vid en börs eller en auktoriserad marknadsplats, skall även tillämpa 6 kap.

1 a § årsredovisningslagen om förvaltningsberättelsens innehåll.

Bankaktiebolag, kreditmarknadsbolag och värdepappersbolag, vars aktier är upptagna till handel på en reglerad marknad i Sverige, skall även tillämpa 6 kap. 1 a § årsredovisningslagen om förvaltningsberättelsens innehåll.

Lydelse enligt prop. 2006/07:65 Föreslagen lydelse

U

2. Företag som inte omfattas av 5 a kap. 5 § lagen (1992:543) om börs- och clearingverksamhet får tillämpa äldre bestämmelser i

2. Företag som inte omfattas av 16 kap. 5 § lagen (2007:000) om värdepappersmarknaden får tilllämpa bestämmelserna i 9 kap. 2

TP

3

PT

EGT L 243, 11.9.2002, s. 1 (Celex 32002R1606).

TP

4

PT

Senaste lydelse 2006:566.

153

9 kap. 2 och 3 §§ om delårsrapportens innehåll m.m. för räkenskapsår som avslutas senast den 30 juni 2008, med det undantaget att delårsrapporten i banker och hypoteksinstitut skall ges in till registreringsmyndigheten. Hänvisningarna i 9 kap. 2 och 3 §§ till bestämmelserna i 9 kap. årsredovisningslagen (1995:1554) skall då avse de bestämmelsernas lydelse före den 1 juli 2007.

och 3 §§ om delårsrapportens innehåll m.m. i deras lydelse före den 1 juli 2007 för räkenskapsår som avslutas senast den 30 juni 2008, med det undantaget att delårsrapporten i banker och hypoteksinstitut skall ges in till registreringsmyndigheten. Hänvisningarna i 9 kap. 2 och 3 §§ till bestämmelserna i 9 kap. årsredovisningslagen (1995:1554) skall då avse de bestämmelsernas lydelse före den 1 juli 2007.

U

Denna lag träder i kraft den 1 november 2007.

154

2.16 Förslag till lag om ändring i lagen (1995:1560) om årsredovisning i försäkringsföretag

Härigenom föreskrivs att 6 kap. 1 § och 9 kap. 1 § lagen (1995:1560) om årsredovisning i försäkringsföretag skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

6 kap.

1 §

TPF

1

FPT

Med beaktande av det som föreskrivs i andra stycket skall följande bestämmelser i 6 kap. årsredovisningslagen (1995:1554) tillämpas:

1 § första–fjärde styckena om förvaltningsberättelsens innehåll,

2 § om förslag till dispositioner av vinst eller förlust m.m. och 2 a § om vissa upplysningar i förvaltningsberättelsen i aktiebolag vars aktier är noterade vid en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad.

2 a § om vissa upplysningar i förvaltningsberättelsen i aktiebolag vars aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet.

Det som sägs i 6 kap. 1 § andra stycket 6–8 årsredovisningslagen om upplysningar om kvotvärde skall dock i stället avse nominellt belopp.

Försäkringsaktiebolag, vars aktier är noterade vid en börs eller en auktoriserad marknadsplats, skall även tillämpa 6 kap. 1 a § årsredovisningslagen om förvaltningsberättelsens innehåll. Vid tillämpningen av nämnda paragraf skall vad som sägs om riktlinjer av det slag som avses i 8 kap. 51 § aktiebolagslagen (2005:551) i stället avse riktlinjer av det slag som avses i 8 kap. 9 § försäkringsrörelselagen (1982:713).

Försäkringsaktiebolag, vars aktier är upptagna till handel på en reglerad marknad i Sverige, skall även tillämpa 6 kap. 1 a § årsredovisningslagen om förvaltningsberättelsens innehåll. Vid tillämpningen av nämnda paragraf skall det som sägs om riktlinjer av det slag som avses i 8 kap. 51 § aktiebolagslagen (2005:551) i stället avse riktlinjer av det slag som avses i 8 kap. 9 § försäkringsrörelselagen (1982:713).

Lydelse enligt prop. 2006/07:65 Föreslagen lydelse

9 kap.

1 §

Bestämmelser om företag som skall lämna delårsrapport finns i 5 a kap. lagen (1992:543) om börs- och clearingverksamhet.

Bestämmelser om företag som skall lämna delårsrapport finns i 16 kap. lagen (2007:000) om värdepappersmarknaden.

TP

1

PT

Senaste lydelse 2006:567.

155

U

Denna lag träder i kraft den 1 november 2007.

156

2.17 Förslag till lag om ändring i lagen (1995:1571) om insättningsgaranti

Härigenom föreskrivs att 21 § lagen (1995:1571) om insättningsgaranti skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

21 §

TPF

1

FPT

Om insättningar hos ett institut omfattas av garantin till följd av ett beslut av nämnden enligt 3 § andra stycket men detta inte utgör en förutsättning för tillstånd enligt 4 kap. 4 § första stycket 3 lagen (2004:297) om bank- och finansieringsrörelse eller 3 kap. 4 § femte stycket lagen (1991:981) om värdepappersrörelse, och institutet inte fullgör sina skyldigheter enligt denna lag, får nämnden förelägga institutet att vidta rättelse.

Om insättningar hos ett institut omfattas av garantin till följd av ett beslut av nämnden enligt 3 § andra stycket men detta inte utgör en förutsättning för tillstånd enligt 4 kap. 4 § första stycket 3 lagen (2004:297) om bank- och finansieringsrörelse eller 4 kap. 6 § andra stycket lagen (2007:000) om värdepappersmarknaden, och institutet inte fullgör sina skyldigheter enligt denna lag, får nämnden förelägga institutet att vidta rättelse.

Har institutet inte vidtagit rättelse inom ett år från föreläggandet, får nämnden besluta att garantin inte längre skall gälla beträffande insättningarna. Ett sådant beslut får, när det är fråga om ett utländskt institut från ett EES-land, meddelas endast om den behöriga myndigheten i institutets hemland har samtyckt till beslutet. Är det fråga om ett institut från ett land utanför EES, får beslut om att garantin inte längre skall gälla meddelas endast om tillsynsmyndigheten i institutets hemland har underrättats i förväg om beslutet.

Har nämnden beslutat att garantin inte längre skall gälla beträffande insättningar hos en filial i ett land utanför EES till ett svenskt institut, skall nämnden underrätta tillsynsmyndigheten i det land där filialen finns om beslutet.

U

Denna lag träder i kraft den 1 november 2007.

TP

1

PT

Senaste lydelse 2004:320.

157

2.18 Förslag till lag om ändring i lagen (1997:323) om statlig förmögenhetsskatt

Härigenom föreskrivs att 3, 13 och 14 §§ lagen (1997:323) om statlig förmögenhetsskatt skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

3 §

TPF

1

FPT

Vid beräkning av den skattepliktiga förmögenheten skall som tillgång tas upp

1. privatbostadsfastighet och privatbostadsrätt,

2. småhus med tillhörande tomtmark på lantbruksenhet som på grund av ägarens begäran enligt 2 kap. 9 § tredje stycket inkomstskattelagen (1999:1229) är näringsfastighet,

3. den del av en näringsfastighet som inrymmer en bostadslägenhet som används eller är avsedd att användas av fastighetsägaren för eget eller närståendes boende,

4. aktie i ett aktieslag som är inregistrerat vid börs i det land där aktiebolaget är hemmahörande samt marknadsnoterad aktie i ett aktiebolag som är hemmahörande i Sverige om ett aktieslag i bolaget den 29 maj 1997 var eller senare har varit inregistrerat vid svensk börs med undantag för huvuddelägares aktie,

4. aktie i ett aktieslag som är inregistrerat vid en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet i det land där aktiebolaget är hemmahörande samt marknadsnoterad aktie i ett aktiebolag som är hemmahörande i Sverige om ett aktieslag i bolaget den 29 maj 1997 var eller senare har varit inregistrerat vid en svensk börs eller en reglerad marknad i Sverige med undantag för huvuddelägares aktie,

5. aktie i ett aktieslag som inte är marknadsnoterat i det land där aktiebolaget är hemmahörande med undantag för huvuddelägares aktie i ett aktiebolag i vilket finns ett aktieslag som är marknadsnoterat,

6. annan sådan delägarrätt som avses i 48 kap. 2 § första stycket inkomstskattelagen än aktie om delägarrätten inte är marknadsnoterad samt andel i handelsbolag med undantag för andel i juridisk person till den del den juridiska personen är skattskyldig,

7. annan marknadsnoterad delägarrätt än aktie, marknadsnoterad fordringsrätt och marknadsnoterad tillgång som avses i 52 kap. inkomstskattelagen,

8. livförsäkring med undantag för

a) pensionsförsäkring samt

b) livförsäkring som enbart avser olycks- eller sjukdomsfall eller dödsfall senast vid 70 års ålder och som inte är återköpsbar,

TP

1

PT

Senaste lydelse 2006:235.

158

9. rätt till livränta eller därmed jämförlig utbetalning med undantag för rätt till

a) utbetalning på grund av försäkring,

b) utbetalning på grund av tidigare anställning samt

c) underhållsbidrag, 10. kontobehållning med undantag för behållning på pensionssparkonto,

11. fordran i pengar och liknade betalningsmedel samt fordran avseende marknadsnoterad tillgång som anges i 4, 5 eller 7,

12. pengar och liknande betalningsmedel till den del de sammanlagt överstiger 25 000 kronor,

13. lösöre med undantag för

a) inre lösöre för personligt bruk,

b) yttre lösöre för personligt bruk till den del det enskilda föremålets värde understiger 10 000 kronor,

c) fordon som avses i 2 kap. 2 § första stycket vägtrafikskattelagen (2006:227) samt

d) lösöre som är deponerat på museum eller liknande inrättning, om tillgången inte ingår i sådan näringsverksamhet som avses i 13 kap.1 och 11 §§inkomstskattelagen i annat fall än enligt 2 och 3.

Undantaget i första stycket 4 och 5 för huvuddelägares aktie tillämpas på

1. aktie i ett aktiebolag i vilket aktier var inregistrerade vid börs vid utgången av år 1991, om aktien har innehafts direkt eller indirekt av en huvuddelägare sedan denna tidpunkt,

2. aktie i ett aktiebolag i vilket aktier har inregistrerats vid börs första gången efter utgången av år 1991, om aktien har innehafts direkt eller indirekt av en huvuddelägare sedan inregistreringen,

2. aktie i ett aktiebolag i vilket aktier har inregistrerats vid en börs, en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet första gången efter utgången av år 1991, om aktien har innehafts direkt eller indirekt av en huvuddelägare sedan inregistreringen,

3. aktie i ett aktiebolag i vilket aktier har marknadsnoterats första gången efter utgången av år 1996, om aktien har innehafts direkt eller indirekt av en huvuddelägare sedan marknadsnoteringen,

4. aktie som har förvärvats med stöd av aktie som avses i 1–3, om aktien har innehafts direkt eller indirekt av en huvuddelägare sedan detta förvärv,

5. aktie som avses i 1–4 och som har förvärvats av ett barn eller barnbarn till huvuddelägaren och i förekommande fall därefter åter förvärvats av huvuddelägaren och som har innehafts direkt eller indirekt av ett barn, barnbarn eller av huvuddelägaren sedan först nämnda förvärv.

Med huvuddelägare avses sådan aktieägare som, ensam eller tillsammans med närstående, innehade aktier direkt eller indirekt motsvarande minst 25

Med huvuddelägare avses sådan aktieägare som, ensam eller tillsammans med närstående, innehade aktier direkt eller indirekt motsvarande minst 25

159

procent för röstvärdet av aktierna i bolaget vid utgången av år 1991 i fråga om aktier i ett aktiebolag i vilket aktier var inregistrerade vid den tidpunkten och i övriga fall vid tidpunkten för inregistrering eller marknadsnotering som avses i andra stycket. Som huvuddelägare anses även dödsboet efter sådan aktieägare.

procent av röstvärdet för aktierna i bolaget vid utgången av år 1991 i fråga om aktier i ett aktiebolag i vilket aktier var inregistrerade vid den tidpunkten och i övriga fall vid tidpunkten för inregistrering eller marknadsnotering som avses i andra stycket. Som huvuddelägare anses även dödsboet efter sådan aktieägare.

Med pensionsförsäkring likställs i denna paragraf en sådan livförsäkring som

1. avses i 58 kap. 2 § andra stycket andra meningen inkomstskattelagen (1999:1229), eller

2. uppfyller villkoren i 58 kap.616 §§inkomstskattelagen, om den har meddelats i en sådan verksamhet som avses i 2 kap. 1 § 2 lagen (1998:293) om utländska försäkringsgivares verksamhet i Sverige.

13 §

TPF

2

FPT

Om det i ett aktiebolag finns skilda aktieslag av vilka ett eller flera är inregistrerade vid börs, tas aktie i bolaget som inte är inregistrerad upp till samma värde som de inregistrerade aktierna. Är flera aktieslag inregistrerade, tas aktie som inte är inregistrerad upp till samma värde som de inregistrerade aktier som har den lägsta kursen.

Om det i ett aktiebolag finns skilda aktieslag av vilka ett eller flera är inregistrerade vid en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet, tas aktie i bolaget som inte är inregistrerad upp till samma värde som de inregistrerade aktierna. Är flera aktieslag inregistrerade, tas aktie som inte är inregistrerad upp till samma värde som de inregistrerade aktier som har den lägsta kursen.

Om det i ett aktiebolag som är hemmahörande i Sverige finns skilda aktieslag av vilka ett eller flera är marknadsnoterade utan att vara inregistrerade vid börs och ett aktieslag i bolaget den 29 maj 1997 var eller senare har varit inregistrerat vid svensk börs, tas aktie i bolaget som inte är marknadsnoterad upp till samma värde som de marknadsnoterade aktierna. Är flera aktieslag marknadsnoterade, tas aktie som inte är marknadsnoterad upp till samma värde som de marknadsnoterade

Om det i ett aktiebolag som är hemmahörande i Sverige finns skilda aktieslag av vilka ett eller flera är marknadsnoterade utan att vara inregistrerade vid en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet och ett aktieslag i bolaget den 29 maj 1997 var eller senare har varit inregistrerat vid en svensk börs eller en reglerad marknad i Sverige, tas aktie i bolaget som inte är marknadsnoterad upp till samma värde som de marknads-

TP

2

PT

Senaste lydelse 1997:954.

160

aktier som har den lägsta kursen. noterade aktierna. Är flera aktieslag marknadsnoterade, tas aktie som inte är marknadsnoterad upp till samma värde som de marknadsnoterade aktier som har den lägsta kursen.

14 §

TPF

3

FPT

Vid värdering av delägarrätt som avses i 48 kap. 2 § första stycket inkomstskattelagen (1999:1229) och som inte är marknadsnoterad samt andel i handelsbolag beaktas tillgångar och skulder i den juridiska personen respektive i handelsbolaget i den omfattning som skulle ha gällt om de innehafts direkt av delägaren och inte annat följer av andra stycket eller 13 §. Om tillgången eller skulden ingår i en rörelse hos den juridiska personen respektive handelsbolaget, anses detsamma gälla för delägaren, dock inte i fråga om tillgång som för delägaren vid direkt innehav omfattas av 3 § första stycket 1 och därtill hänförlig skuld.

Aktie i ett aktiebolag som är hemmahörande i Sverige och som inte är marknadsnoterad tas upp till 80 procent av marknadsvärdet om ett aktieslag i bolaget har varit inregistrerat vid svensk börs under beskattningsåret.

Aktie i ett aktiebolag som är hemmahörande i Sverige och som inte är marknadsnoterad tas upp till 80 procent av marknadsvärdet om ett aktieslag i bolaget har varit inregistrerat vid en reglerad marknad i Sverige under beskattningsåret.

Har en andel i ett handelsbolag ett negativt värde, får detta beaktas av delägare som inte har förbehållit sig ett begränsat ansvar för bolagets förbindelser.

U

1. Denna lag träder i kraft den 1 november 2007 och tillämpas första gången vid 2008 års taxering.

2. Vid tillämpningen av 14 § andra stycket vid 2008 års taxering jämställs med aktieslag som har varit inregistrerat vid en reglerad marknad i Sverige aktieslag som har varit inregistrerat vid en svensk börs.

TP

3

PT

Senaste lydelse 2000:1345.

161

2.19 Förslag till lag om ändring i skattebetalningslagen (1997:483)

Härigenom föreskrivs att 5 kap. 9 § skattebetalningslagen (1997:483) skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

5 kap.

9 §

TPF

1

FPT

Skatteavdrag skall inte göras från

1. ränta på ett konto, om räntan är mindre än 100 kronor, 2. ränta eller utdelning till fysiska personer som är begränsat skattskyldiga i Sverige,

3. ränta eller utdelning som enligt skatteavtal är helt undantagen från beskattning i Sverige,

4. ränta på ett förfogarkonto som avses i 8 kap. 6 § andra stycket lagen (2001:1227) om självdeklarationer och kontrolluppgifter, om räntan är mindre än 1 000 kronor,

5. ränta på ett konto för klientmedel,

6. ränta som betalas ut tillsammans med ett annat belopp, om det är okänt för utbetalaren hur stor del av utbetalningen som utgör ränta och utbetalaren därför skall redovisa hela beloppet i kontrolluppgift enligt 8 kap. 5 § andra stycket lagen om självdeklarationer och kontrolluppgifter,

7. ränta eller utdelning som ett utländskt företag skall lämna kontrolluppgift för enligt 13 kap. 1 § lagen om självdeklarationer och kontrolluppgifter,

8. utdelning på aktier i ett svenskt aktiebolag som inte är avstämningsbolag enligt 1 kap. 10 § aktiebolagslagen (2005:551) eller 3 kap. 8 § försäkringsrörelselagen (1982:713),

9. utdelning på andelar i en svensk ekonomisk förening, 10. utdelning från en utländsk juridisk person, om utdelningen inte har betalats ut genom en central värdepappersförvarare eller genom någon som bedriver valutahandel eller genom ett värdepappersinstitut hos vilket ett utländskt fondpapper förvaras i depå eller kontoförs eller en rättighet eller en skyldighet som anknyter till sådant fondpapper kontoförs,

10. utdelning från en utländsk juridisk person, om utdelningen inte har betalats ut genom en central värdepappersförvarare eller genom någon som bedriver valutahandel eller genom ett värdepappersinstitut hos vilket ett utländskt finansiellt instrument förvaras i depå eller kontoförs eller en rättighet eller en skyldighet som anknyter till ett sådant finansiellt instrument kontoförs,

11. ränta på obligation, förlagsbevis eller någon annan för den allmänna rörelsen avsedd förskrivning som har betalats ut mot att

11. ränta på obligation, förlagsbevis eller någon annan för den allmänna rörelsen avsedd förskrivning som har betalats ut mot att

TP

1

PT

Senaste lydelse 2006:579.

162

kupong eller kvitto har lämnats och inte har betalats ut genom en central värdepappersförvarare eller genom ett värdepappersinstitut hos vilket ett utländskt fondpapper förvaras i depå eller kontoförs eller en rättighet eller en skyldighet som anknyter till sådant fondpapper kontoförs, eller

kupong eller kvitto har lämnats och inte har betalats ut genom en central värdepappersförvarare eller genom ett värdepappersinstitut hos vilket ett utländskt finansiellt instrument förvaras i depå eller kontoförs eller en rättighet eller en skyldighet som anknyter till ett sådant finansiellt instrument kontoförs, eller

12. räntekompensation som förvärvaren av en fordringsrätt eller delägarrätt betalar till överlåtaren för upplupen men inte förfallen ränta.

U

Denna lag träder i kraft den 1 november 2007.

163

2.20 Förslag till lag om ändring i lagen (1998:710) med vissa bestämmelser om Premiepensionsmyndigheten

Härigenom föreskrivs att 3 § lagen (1998:710) med vissa bestämmelser om Premiepensionsmyndigheten skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

3 §

Premiepensionsmyndigheten får inte förvärva så många aktier i ett svenskt aktiebolag, vars aktier är noterade, att röstetalet för dem tillsammans med myndighetens övriga aktier i samma bolag överstiger fem procent av röstetalet för samtliga aktier i bolaget. Med notering avses notering vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad.

Premiepensionsmyndigheten får inte förvärva så många aktier i ett svenskt aktiebolag, vars aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet, att röstetalet för dem tillsammans med myndighetens övriga aktier i samma bolag överstiger fem procent av röstetalet för samtliga aktier i bolaget.

U

Denna lag träder i kraft den 1 november 2007.

164

2.21 Förslag till lag om ändring i lagen (1998:1479) om kontoföring av finansiella instrument

Härigenom föreskrivs att 1 kap. 3 §, 4 kap. 17 §, 9 kap. 1 § och 10 kap. 1 § lagen (1998:1479) om kontoföring av finansiella instrument skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

1 kap.

3 §

TPF

1

FPT

I denna lag betyder: central värdepappersförvarare: företag som har auktorisation enligt 2 kap. att kontoföra finansiella instrument i avstämningsregister,

U

avstämningsbolag

U

: sådant av-

stämningsbolag som avses i aktiebolagslagen (2005:000) eller försäkringsrörelselagen (1982:713),

U

avstämningsbolag

U

: sådant av-

stämningsbolag som avses i aktiebolagslagen (2005:551) eller försäkringsrörelselagen (1982:713),

emittent: i fråga om aktier aktiebolaget och i fråga om annat finansiellt instrument utgivaren eller utfärdaren av instrumentet,

kontoförande institut: den som av en central värdepappersförvarare medgetts rätt att vidta registreringsåtgärder i avstämningsregister,

U

finansiellt instrument

U

: detsamma

som i 1 kap. 1 § lagen (1991:980) om handel med finansiella instrument,

U

finansiellt instrument

U

: detsamma

som i 1 kap. 4 § första stycket 1 lagen (2007:000) om värdepappersmarknaden,

skuldförbindelse: ensidig skuldförbindelse avsedd för allmän omsättning,

U

värdepappersinstitut

U

: detsamma

som i 1 kap. 2 § lagen (1991:981) om värdepappersrörelse,

U

kvalificerat innehav

U

: ett direkt

eller indirekt ägande i ett företag, om innehavet representerar 10 procent eller mer av kapitalet eller av samtliga röster eller annars möjliggör ett väsentligt inflytande över ledningen av företaget,

U

koncern:

U

detsamma som i 1 kap.

11 och 12 §§aktiebolagslagen, varvid vad som sägs om moderbolag skall tillämpas även på andra juridiska personer än aktiebolag.

U

värdepappersinstitut

U

: detsamma

som i 1 kap. 5 § 27 lagen om värdepappersmarknaden,

U

kvalificerat innehav

U

: ett direkt

eller indirekt ägande i ett företag, om innehavet representerar 10 procent eller mer av kapitalet eller av samtliga röster eller annars möjliggör ett väsentligt inflytande över ledningen av företaget, och

U

koncern:

U

detsamma som i 1 kap.

11 och 12 §§aktiebolagslagen, varvid det som sägs om moderbolag skall tillämpas även på andra juridiska personer än aktiebolag.

TP

1

PT

Senaste lydelse 2005:558.

165

4 kap.

17 §

TPF

2

FPT

På ett avstämningskonto skall anges

1. kontohavarens namn och personnummer, organisationsnummer eller annat identifieringsnummer samt postadress,

2. panthavares namn och personnummer, organisationsnummer eller annat identifieringsnummer samt postadress,

3. det antal finansiella instrument som kontot omfattar, 4. i förekommande fall att kontohavaren har förvaltare enligt 11 kap. 7 § föräldrabalken med uppdrag som omfattar förvaltning av aktierna eller att aktierna företräds av en förvaltare som förordnats enligt 14 kap. 9 § lagen (2004:297) om bank- och finansieringsrörelse, 6 kap. 3 g § lagen (1991:981) om värdepappersrörelse, 11 kap. 2 h § lagen (1992:543) om börs- och clearingverksamhet eller 3 kap. 2 e § försäkringsrörelselagen (1982:713),

4. i förekommande fall att kontohavaren har förvaltare enligt 11 kap. 7 § föräldrabalken med uppdrag som omfattar förvaltning av aktierna eller att aktierna företräds av en förvaltare som förordnats enligt 14 kap. 9 § lagen (2004:297) om bank- och finansieringsrörelse, 24 kap. 10 § lagen (2007:000) om värdepappersmarknaden eller 3 kap. 2 e § försäkringsrörelselagen (1982:713),

5. pantsättning och förekomst av annan särskild rätt som gäller ett finansiellt instrument,

6. konkurs avseende kontohavaren samt utmätning, kvarstad eller betalningssäkring avseende ett finansiellt instrument eller avseende panträtt i detta,

7. inskränkning enligt 13 kap. 19 § andra stycket eller 14 kap. 21 § andra stycketföräldrabalken.

9 kap.

1 §

Centrala värdepappersförvarare står under tillsyn av Finansinspektionen. I fråga om upplysningsskyldighet, ägarprövning, bedrivandet av tillsynen och avgifter till Finansinspektionen tillämpas 11 kap.1, 25 och 9 §§ lagen (1992:543) om börs- och clearingverksamhet på motsvarande sätt.

Centrala värdepappersförvarare står under tillsyn av Finansinspektionen. I fråga om upplysningsskyldighet, ägarprövning, bedrivandet av tillsynen och avgifter till Finansinspektionen tillämpas 23 kap. 1, 2, 7, 11, 12 och 14 §§ och 15 § 1, 3 och 4 samt 24 kap. 1 §, 3–6 §§, 7 § första stycket 1 och 2, andra och tredje styckena samt 810 §§ lagen (2007:000) om värdepappersmarknaden på motsvarande sätt.

TP

2

PT

Senaste lydelse 2005:558.

166

10 kap.

1 §

Beslut som Finansinspektionen meddelar med stöd av 1 kap. 1 §, 2 kap. 3 § och 9 kap. 3 § får överklagas hos kammarrätten.

Beträffande överklagande av beslut i frågor som avses i 9 kap. 1 § tillämpas 12 kap. 1 § första och tredje styckena lagen (1992:543) om börs- och clearingverksamhet på motsvarande sätt.

Andra beslut som Finansinspektionen meddelar enligt denna lag får överklagas hos länsrätten. Detta gäller dock inte beslut i ärenden som avses i 20 § första stycket 5 förvaltningslagen (1986:223). Prövningstillstånd krävs vid överklagande till kammarrätten av länsrättens avgörande.

Finansinspektionens beslut enligt denna lag får, med undantag av det som följer av hänvisningen i 9 kap. 1 § till bestämmelser i lagen (2007:000) om värdepappersmarknaden, överklagas hos allmän förvaltningsdomstol. Detta gäller dock inte beslut i ärenden som avses i 20 § första stycket 5 förvaltningslagen (1986:223). Prövningstillstånd krävs vid överklagande till kammarrätten.

Inspektionen får bestämma att ett beslut om förbud eller föreläggande enligt 9 kap. 2 § eller om återkallelse enligt 9 kap. 3 § skall gälla omedelbart.

Finansinspektionen får bestämma att ett beslut om förbud eller föreläggande enligt 9 kap. 2 § eller om återkallelse enligt 9 kap. 3 § skall gälla omedelbart.

U

Denna lag träder i kraft den 1 november 2007.

167

2.22 Förslag till lag om ändring i lagen (1998:1757) om förvaltning av vissa fonder inom socialförsäkringsområdet

Härigenom föreskrivs att 5 § lagen (1998:1757) om förvaltning av vissa fonder inom socialförsäkringsområdet skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

5 §

Om det är uppenbart att en fond annars skulle lida en avsevärd förlust får Kammarkollegiet skydda en fordran genom att på offentlig auktion eller på en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad köpa in egendom som är utmätt eller pantsatt för fordringen eller överta egendom som betalning för fordringen. Egendom som förvärvats på detta sätt skall avyttras så snart det är lämpligt och senast då det kan ske utan förlust.

Om det är uppenbart att en fond annars skulle lida en avsevärd förlust får Kammarkollegiet skydda en fordran genom att på offentlig auktion eller på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet köpa in egendom som är utmätt eller pantsatt för fordringen eller överta egendom som betalning för fordringen. Egendom som förvärvats på detta sätt skall avyttras så snart det är lämpligt och senast då det kan ske utan förlust.

Kammarkollegiet får anta ackord vid betalningsinställelse eller konkurs.

U

1. Denna lag träder i kraft den 1 november 2007.

2. I fråga om förvärv som har skett före ikraftträdandet gäller äldre bestämmelser.

168

2.23 Förslag till lag om ändring i lagen (1999:158) om investerarskydd

Härigenom föreskrivs att 2 § lagen (1999:158) om investerarskydd skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

2 §

TPF

1

FPT

I denna lag betyder

1. värdepappersinstitut: detsamma som anges i 1 kap. 2 § lagen (1991:981) om värdepappersrörelse,

1. värdepappersinstitut: detsamma som anges i 1 kap. 5 § 27 lagen (2007:000) om värdepappersmarknaden,

2. fondbolag: ett sådant bolag som anges i 1 kap. 1 § 7 lagen (2004:46) om investeringsfonder,

3. förvaltningsbolag: ett sådant utländskt företag som anges i 1 kap. 1 § 13 lagen om investeringsfonder, som driver verksamhet från filial här i landet med stöd av 1 kap. 6 § samma lag,

3. förvaltningsbolag: ett sådant utländskt företag som anges i 1 kap. 1 § 13 lagen om investeringsfonder, som driver verksamhet från filial i Sverige med stöd av 1 kap. 6 § samma lag,

4. investerare: den som anlitat ett värdepappersinstitut, ett fondbolag eller ett förvaltningsbolag för utförande av en investeringstjänst eller den för vars räkning tjänsten utförs,

5. investeringstjänst: en sådan tjänst som avses i 1 kap. 3 § första stycket och 3 kap. 4 § första stycket 2 och 3 lagen om värdepappersrörelse, 7 kap. 1 § andra stycket 9 lagen (2004:297) om bank- och finansieringsrörelse samt 1 kap. 4 § såvitt avser förvaltning av någon annans finansiella instrument, 3 kap. 1 § och 7 kap. 1 § första stycket 1 och 2 lagen om investeringsfonder.

5. investeringstjänst: en sådan tjänst som avses i 2 kap. 1 § och 2 § första stycket 1 lagen om värdepappersmarknaden, 7 kap. 1 § andra stycket 9 lagen (2004:297) om bank- och finansieringsrörelse samt 1 kap. 4 § såvitt avser diskretionär portföljförvaltning, 3 kap. 1 § och 7 kap. 1 § första stycket 1 och 2 lagen om investeringsfonder, och

6. finansiella instrument: detsamma som anges i 1 kap. 1 § lagen (1991:980) om handel med finansiella instrument.

6. finansiella instrument: detsamma som anges i 1 kap. 4 § första stycket 1 lagen om värdepappersmarknaden.

U

1. Denna lag träder i kraft den 1 november 2007.

2. I fråga om investeringstjänster som har utförts före ikraftträdandet gäller äldre bestämmelser.

TP

1

PT

Senaste lydelse 2004:324.

169

2.24 Förslag till lag om ändring i bokföringslagen (1999:1078)

Härigenom föreskrivs att 8 kap. 1 § bokföringslagen (1999:1078) skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

8 kap.

1 §

Bokföringsnämnden ansvarar för utvecklandet av god redovisningssed. Finansinspektionen ansvarar för utvecklandet av god redovisningssed i sådana företag som omfattas av lagen (1995:1559) om årsredovisning i kreditinstitut och värdepappersbolag och lagen (1995:1560) om årsredovisning i försäkringsföretag i den utsträckning det är påkallat av dessa företags särart.

Av 1 kap. 5 § lagen om årsredovisning i kreditinstitut och värdepappersbolag, 1 kap. 4 § lagen om årsredovisning i försäkringsföretag och 11 kap. 2 § lagen (1992:543) om börs- och clearingverksamhet följer att regeringen får bemyndiga Finansinspektionen att meddela föreskrifter om redovisning för finansiella företag.

Av 1 kap. 5 § lagen om årsredovisning i kreditinstitut och värdepappersbolag, 1 kap. 4 § lagen om årsredovisning i försäkringsföretag och 23 kap. 15 § 3 lagen (2007:000) om värdepappersmarknaden följer att regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om redovisning för finansiella företag.

U

Denna lag träder i kraft den 1 november 2007.

170

2.25 Förslag till lag om ändring i inkomstskattelagen (1999:1229)

Härigenom föreskrivs att 17 kap. 19 §, 24 kap. 8 §, 25 a kap. 15 §, 48 kap. 5 §, 49 a kap. 7 §, 55 kap. 5 § och 56 kap. 3 §inkomstskattelagen (1999:1229) skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

17 kap.

19 §

TPF

1

FPT

Med finansiellt instrument avses i 19 a–20 c §§ detsamma som i 4 kap.14 a och 14 c §§årsredovisningslagen (1995:1554).

Bestämmelserna i 19 a–20 c §§ gäller inte i fråga om elcertifikat, utsläppsrätter, utsläppsminskningsenheter och certifierade utsläppsminskningar som innehas av

1. skattskyldiga som avses i 22 a och b §§, eller

2. företag som enligt 22 c § ingår i samma intressegemenskap som en sådan skattskyldig som avses i 1.

24 kap.

8 §

Är andelarna i det låntagande företaget noterade på en svensk börs eller auktoriserad marknadsplats, skall vinstandelsräntan dras av även om de som äger andelar i företaget har fått en sådan företrädesrätt till teckning av lånet som har lämnats i förhållande till deras innehav av andelar.

Är andelarna i det låntagande företaget upptagna till handel på en reglerad marknad i Sverige, skall vinstandelsräntan dras av även om de som äger andelar i företaget har fått en sådan företrädesrätt till teckning av lånet som har lämnats i förhållande till deras innehav av andelar.

Om räntan skall dras av, skall det sammanlagda värde som genom företrädesrätterna kan anses ha tillförts andelsägarna tas upp av företaget. Värdet skall tas upp som intäkt det beskattningsår då teckningen av lånet avslutas.

25 a kap.

15 §

TPF

2

FPT

Som likvida tillgångar räknas inte

1. andelar och aktiebaserade delägarrätter i företag som är i sådan intressegemenskap som avses i 2 § 1 med det företag som den avyttrade delägarrätten är hänförlig till, eller

TP

1

PT

Senaste lydelse 2006:620. Ändringen innebär att andra stycket upphävs.

TP

2

PT

Senaste lydelse 2003:224.

171

2. värdepapper som är lager i värdepappersrörelse enligt lagen (1991:981) om värdepappersrörelse.

2. värdepapper som är lager i värdepappersrörelse enligt lagen (2007:000) om värdepappersmarknaden.

Värdepapper som är lager i en utländsk motsvarighet till sådan rörelse som avses i första stycket 2 och som innehas av en utländsk juridisk person räknas inte som likvida medel om den utländska juridiska personen hör hemma och är skattskyldig till inkomstskatt i en stat

– som är medlem i Europeiska ekonomiska samarbetsområdet, eller – med vilken Sverige har ett skatteavtal och personen omfattas av avtalets regler om begränsning av beskattningsrätten och har hemvist i staten enligt avtalet.

48 kap.

5 §

En delägarrätt eller fordringsrätt anses marknadsnoterad om den är noterad på svensk eller utländsk börs eller, utan att vara noterad på börs, är föremål för kontinuerlig allmänt tillgänglig notering på grundval av marknadsmässig omsättning.

En delägarrätt eller fordringsrätt anses marknadsnoterad om den är upptagen till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet eller, utan att vara upptagen till handel på en sådan marknad, är föremål för kontinuerlig allmänt tillgänglig notering på grundval av marknadsmässig omsättning.

49 a kap.

7 §

TPF

3

FF

2

FPT

Med likvida tillgångar avses i detta kapitel kontanter, värdepapper och liknande tillgångar. Som likvida tillgångar räknas också andra tillgångar om

1. tillgångarna anskaffats tidigast två år före avyttringen,

2. tillgångarna saknar affärsmässigt samband med verksamheten sådan den bedrevs intill två år före avyttringen, och

3. det inte framgår att anskaffningen skett i annat syfte än att tillgångarna lätt skulle kunna avyttras efter avyttringen av andelen.

Som likvida tillgångar räknas inte

1. andelar i företag i intressegemenskap,

1. andelar i företag i intressegemenskap, eller

2. värdepapper som är lager i värdepappersrörelse enligt lagen (1991:981) om värdepappersrörelse.

2. värdepapper som är lager i värdepappersrörelse enligt lagen (2007:000) om värdepappersmarknaden.

Värdepapper som är lager i en utländsk motsvarighet till sådan rörelse som avses i andra stycket 2 och som innehas av en utländsk juridisk

TP

3

PT

Senaste lydelse 2003:224.

172

person räknas inte som likvida medel om den utländska juridiska personen hör hemma och är skattskyldig till inkomstskatt i en stat

– som är medlem i Europeiska ekonomiska samarbetsområdet, eller – med vilken Sverige har ett skatteavtal och personen omfattas av avtalets regler om begränsning av beskattningsrätten och har hemvist i staten enligt avtalet.

55 kap.

5 §

Ersättning som betalas ut av Insättningsgarantinämnden enligt lagen (1999:158) om investerarskydd eller av en försäkringsgivare på grund av en försäkring som ett värdepappersbolag tecknat i enlighet med bestämmelsen i 5 kap. 2 § lagen (1991:981) om värdepappersrörelse skall anses utbetald av det institut där investeringen finns.

Ersättning som betalas ut av Insättningsgarantinämnden enligt lagen (1999:158) om investerarskydd eller av en försäkringsgivare på grund av en försäkring som ett värdepappersbolag tecknat för skadeståndsskyldighet som det kan komma att ådra sig när tjänster utförs i rörelsen skall anses utbetald av det institut där investeringen finns.

56 kap.

3 §

Aktiebolag vars aktier är noterade vid en svensk eller utländsk börs och privatbostadsföretag är inte fåmansföretag.

Aktiebolag vars aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet och privatbostadsföretag är inte fåmansföretag.

U

1. Denna lag träder i kraft den 1 november 2007 och tillämpas första gången vid 2008 års taxering.

2. Har beskattningsåret påbörjats före ikraftträdandet tillämpas äldre bestämmelser för den del av beskattningsåret som avser tiden före ikraftträdandet. Det som sägs i första meningen tillämpas inte för bestämmelsen i 17 kap. 19 §.

173

2.26 Förslag till lag om ändring i lagen (1999:1309) om system för avveckling av förpliktelser på finansmarknaden

Härigenom föreskrivs att 2, 4, 7, 8 och 16 §§ lagen (1999:1309) om system för avveckling av förpliktelser på finansmarknaden skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

2 §

I denna lag avses med administratör: ett företag som är ansvarigt för verksamheten i ett avvecklingssystem; företaget anses som deltagare i systemet,

anmält avvecklingssystem: ett avvecklingssystem som en stat inom EES har anmält till Europeiska kommissionen eller till Eftas övervakningsmyndighet,

central värdepappersförvarare: ett företag som har auktorisation att kontoföra finansiella instrument i avstämningsregister enligt lagen (1998:1479) om kontoföring av finansiella instrument,

U

clearingorganisation

U

: ett företag

som har tillstånd att bedriva clearingverksamhet enligt lagen (1992:543) om börs- och clearingverksamhet,

U

clearingorganisation

U

: ett företag

som har tillstånd att driva clearingverksamhet enligt lagen (2007:000) om värdepappersmarknaden,

EES: Europeiska ekonomiska samarbetsområdet, kollektivt obeståndsförfarande: konkurs, företagsrekonstruktion eller annat därmed jämförbart förfarande.

4 §

TPF

1

FPT

Ett avvecklingssystem skall ha en administratör. Administratör i ett avvecklingssystem får vara:

1. clearingorganisation,

2. central värdepappersförvarare,

3. företag med tillstånd att driva bankrörelse enligt lagen (2004:297) om bank- och finansieringsrörelse, samt

4. företag med tillstånd enligt 1 kap. 3 § första stycket 1, 2 eller 4 lagen (1991:981) om värdepappersrörelse.

4. företag med tillstånd enligt 2 kap. 1 § 1, 2, 4 eller 8 lagen (2007:000) om värdepappersmarknaden.

7 §

TPF

2

FPT

Ett avvecklingssystem som uppfyller kraven i 5 och 8 §§ samt administreras av ett företag med tillstånd att driva bankrörelse enligt lagen (2004:297) om bank- och finansieringsrörelse eller

Ett avvecklingssystem som uppfyller kraven i 5 och 8 §§ samt administreras av ett företag med tillstånd att driva bankrörelse enligt lagen (2004:297) om bank- och finansieringsrörelse eller

TP

1

PT

Senaste lydelse 2004:325.

TP

2

PT

Senaste lydelse 2004:325.

174

tillstånd enligt 1 kap. 3 § första stycket 1, 2 eller 4 lagen (1991:981) om värdepappersrörelse skall endast godkännas om det finns särskilda skäl och systemet tillgodoser de säkerhetskrav som är förenade med verksamheten samt är organiserat på ett sådant sätt att deltagarnas ekonomiska ställning i systemet kan överblickas. Vid bedömningen av om det finns särskilda skäl skall systemets betydelse för den finansiella stabiliteten beaktas.

tillstånd enligt 2 kap. 1 § 1, 2, 4 eller 8 lagen (2007:000) om värdepappersmarknaden skall endast godkännas om det finns särskilda skäl och systemet tillgodoser de säkerhetskrav som är förenade med verksamheten samt är organiserat på ett sådant sätt att deltagarnas ekonomiska ställning i systemet kan överblickas. Vid bedömningen av om det finns särskilda skäl skall systemets betydelse för den finansiella stabiliteten beaktas.

För godkännande enligt första stycket krävs vidare att administratören redovisar en plan för verksamheten. I planen skall de huvudsakliga risker som är förenade med verksamheten beskrivas liksom hur dessa risker skall hanteras (riskhanteringsplan).

8 §

TPF

3

FPT

Deltagare i ett avvecklingssystem får vara:

1. Riksbanken och andra centralbanker,

2. Riksgäldskontoret och utländska offentliga institutioner som i sitt hemland driver verksamhet som är jämförbar med kontorets,

3. clearingorganisationer,

4. centrala värdepappersförvarare, 5. företag som har tillstånd att driva bankrörelse enligt lagen (2004:297) om bank- och finansieringsrörelse,

6. företag som har tillstånd enligt 1 kap. 3 § första stycket lagen (1991:981) om värdepappersrörelse,

6. företag som har tillstånd enligt 2 kap. 1 § lagen (2007:000) om värdepappersmarknaden,

7. utländska företag som i hemlandet driver sådan verksamhet som avses i 3–6, samt

8. annan juridisk person som för egen räkning avvecklar förpliktelser att leverera finansiella instrument i systemet.

Utländska företag som avses i första stycket 7 skall i hemlandet stå under betryggande tillsyn av en myndighet eller något annat behörigt organ.

16 §

TPF

4

FPT

Godkännande av ett avvecklingssystem skall återkallas av Finansinspektionen om

1. administratörens tillstånd för clearingverksamhet enligt lagen (1992:543) om börs- och clearingverksamhet eller auktorisation som central värdepappersförvarare

1. administratörens tillstånd för clearingverksamhet enligt lagen (2007:000) om värdepappersmarknaden eller auktorisation som central värdepappersförvarare

TP

3

PT

Senaste lydelse 2004:325.

TP

4

PT

Senaste lydelse 2004:325.

175

enligt lagen (1998:1479) om kontoföring av finansiella instrument har återkallats,

enligt lagen (1998:1479) om kontoföring av finansiella instrument har återkallats,

2. administratörens tillstånd att driva bankrörelse enligt lagen (2004:297) om bank- och finansieringsrörelse eller tillstånd enligt 1 kap. 3 § första stycket 1, 2 eller 4 lagen (1991:981) om värdepappersrörelse har återkallats, eller

2. administratörens tillstånd att driva bankrörelse enligt lagen (2004:297) om bank- och finansieringsrörelse eller tillstånd enligt 2 kap. 1 § 1, 2, 4 eller 8 lagen om värdepappersmarknaden har återkallats, eller

3. avvecklingssystemet inte längre uppfyller kraven i denna lag. Finansinspektionen skall omedelbart underrätta Europeiska kommissionen samt Eftas övervakningsmyndighet om återkallelsen.

Om det är tillräckligt får inspektionen i de fall som anges i första stycket 3 meddela varning i stället för att återkalla godkännandet.

U

Denna lag träder i kraft den 1 november 2007.

176

2.27 Förslag till lag om ändring i lagen (2000:35) om byte av redovisningsvaluta i finansiella företag

Härigenom föreskrivs att 2 § lagen (2000:35) om byte av redovisningsvaluta i finansiella företag skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

2 §

TPF

1

FPT

I denna lag avses med

1. försäkringsbolag: försäkringsaktiebolag och ömsesidigt försäkringsbolag som omfattas av försäkringsrörelselagen (1982:713),

2. understödsförening: förening som avses i 1 kap. 1 § lagen (1972:262) om understödsföreningar,

3. kreditinstitut: bankaktiebolag, sparbank och medlemsbank samt kreditmarknadsföretag enligt 1 kap. 5 § 11 lagen (2004:297) om bank- och finansieringsrörelse och institut för elektroniska pengar enligt 1 kap. 2 § lagen (2002:149) om utgivning av elektroniska pengar,

4. finansiellt företag: de företag som anges i punkterna 1–3 samt

a) värdepappersbolag enligt 1 kap. 2 § 2 lagen (1991:981) om värdepappersrörelse,

1.

U

försäkringsbolag

U

: försäk-

ringsaktiebolag och ömsesidigt försäkringsbolag som omfattas av försäkringsrörelselagen (1982:713),

2.

U

understödsförening

U

: förening

som avses i 1 kap. 1 § lagen (1972:262) om understödsföreningar,

3.

U

kreditinstitut

U

: bankaktiebolag,

sparbank och medlemsbank samt kreditmarknadsföretag enligt 1 kap. 5 § 11 lagen (2004:297) om bank- och finansieringsrörelse och institut för elektroniska pengar enligt 1 kap. 2 § lagen (2002:149) om utgivning av elektroniska pengar,

4.

U

finansiellt företag

U

: de företag

som anges i 1–3 samt

a) värdepappersbolag enligt 1 kap. 5 § 26 lagen (2007:000) om värdepappersmarknaden,

b) fondbolag enligt 1 kap. 1 § 7 lagen (2004:46) om investeringsfonder,

c) börs enligt 1 kap. 4 § 1 lagen (1992:543) om börs- och clearingverksamhet,

c) börs enligt 1 kap. 5 § 3 lagen om värdepappersmarknaden,

d) auktoriserad marknadsplats enligt 1 kap. 4 § 3 lagen om börs- och clearingverksamhet,

e) clearingorganisation enligt 1 kap. 4 § 5 lagen om börs- och clearingverksamhet och

f) central värdepappersförvarare enligt 1 kap. 3 § lagen (1998:1479) om kontoföring av finansiella instrument,

d) svensk clearingorganisation enligt 1 kap. 5 § 5 lagen om värdepappersmarknaden och

e) central värdepappersförvarare enligt 1 kap. 3 § lagen (1998:1479) om kontoföring av finansiella instrument,

TP

1

PT

Senaste lydelse 2006:1381.

177

5. finansiell företagsgrupp: grupp av företag som avses i 9 kap. 1 § lagen (2006:1371) om kapitaltäckning och stora exponeringar eller annan grupp av företag på vilka, enligt föreskrift meddelad med stöd av 13 kap. 1 § 33 samma lag, bestämmelserna om finansiell företagsgrupp skall tillämpas och

6. koncern: detsamma som i 1 kap.11 och 12 §§aktiebolagslagen (2005:551), varvid vad som sägs om moderbolag tillämpas även på andra juridiska personer än aktiebolag.

5.

U

finansiell företagsgrupp

U

:

grupp av företag som avses i 9 kap. 1 § lagen (2006:1371) om kapitaltäckning och stora exponeringar eller annan grupp av företag på vilka, enligt föreskrift meddelad med stöd av 13 kap. 1 § 33 samma lag, bestämmelserna om finansiell företagsgrupp skall tillämpas, och

6.

U

koncern

U

: detsamma som i

1 kap.11 och 12 §§aktiebolagslagen (2005:551), varvid det som sägs om moderbolag tillämpas även på andra juridiska personer än aktiebolag.

U

Denna lag träder i kraft den 1 november 2007.

178

2.28 Förslag till lag om ändring i lagen (2000:192) om allmänna pensionsfonder (AP-fonder)

Härigenom föreskrivs att 4 kap.5, 6, 8 och 9 §§ lagen (2000:192) om allmänna pensionsfonder (AP-fonder) skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

4 kap.

5 §

Första–Fjärde AP-fonderna får endast förvärva sådana aktier eller andra andelar i företag som är, eller inom ett år från emissionen av dem avses bli, noterade vid en börs eller någon annan reglerad marknad. Denna begränsning gäller inte aktier och andra andelar i

Första–Fjärde AP-fonderna får bara förvärva sådana aktier eller andra andelar i företag som är, eller inom ett år från emissionen av dem avses bli, upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet (EES). Denna begränsning gäller inte aktier och andra andelar i

1. företag som har till huvudsakligt ändamål att äga eller förvalta fast egendom eller tomträtt (fastighetsbolag), eller

2. företag som har till huvudsakligt ändamål att äga och förvalta sådana aktier eller andra andelar i företag som inte är noterade vid en börs eller någon annan reglerad marknad (riskkapitalföretag).

2. företag som har till huvudsakligt ändamål att äga och förvalta sådana aktier eller andra andelar i företag som inte är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför EES (riskkapitalföretag).

6 §

Var och en av Första–Fjärde AP-fonderna får inneha sådana aktier i svenska aktiebolag som är noterade vid en svensk börs eller en auktoriserad marknadsplats till ett marknadsvärde som uppgår till högst två procent av det totala marknadsvärdet av sådana aktier i bolagen.

Var och en av Första–Fjärde AP-fonderna får inneha sådana aktier i svenska aktiebolag som är upptagna till handel på en reglerad marknad i Sverige till ett marknadsvärde som uppgår till högst två procent av det totala marknadsvärdet av sådana aktier i bolagen.

Vid tillämpning av första stycket skall inte beaktas

1. sådana aktier i bolagen som ingår i svenska eller utländska fonder i vilka AP-fonden innehar andelar som inte medför rätt att rösta för aktierna, och

2. aktier i fastighetsbolag i vilka fonden innehar så många aktier att röstetalet för dem överstiger tio procent av röstetalet för samtliga aktier i bolaget.

179

8 §

Av var och en av Första–Fjärde AP-fondernas tillgångar, värderade till marknadsvärdet, får högst fem procent bestå av

1. sådana aktier eller andra andelar i riskkapitalföretag som inte är noterade vid en börs eller någon annan reglerad marknad,

1. sådana aktier eller andra andelar i riskkapitalföretag som inte är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför EES,

2. fordringsrätter som inte är noterade vid en börs eller någon annan reglerad marknad, och

2. fordringsrätter som inte är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför EES, och

3. andelar i svenska och utländska fonder som huvudsakligen placerar i sådana aktier eller andra andelar i företag som inte är noterade vid en börs eller någon annan reglerad marknad.

3. andelar i svenska och utländska fonder som huvudsakligen placerar i sådana aktier eller andra andelar i företag som inte är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför EES.

Ingen av Första–Fjärde AP-fonderna får vara komplementär i ett svenskt eller utländskt kommanditbolag.

9 §

Ingen av Första–Fjärde AP-fonderna får inneha så många aktier eller andra andelar i ett företag att röstetalet för dem överstiger tio procent eller, beträffande sådana riskkapitalföretag som avses i 8 § första stycket 1, trettio procent av röstetalet för samtliga aktier eller andelar i företaget.

Begränsningen i första stycket gäller inte 1. sådana aktier eller andra andelar i fastighetsbolag som inte är noterade vid en börs eller någon annan reglerad marknad,

1. sådana aktier eller andra andelar i fastighetsbolag som inte är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför EES,

2. sådana aktier eller andra andelar i fastighetsbolag som är noterade vid en börs eller någon annan reglerad marknad och i vilka bolag fonden ensam eller tillsammans med någon eller några av de andra tre AP-fonderna innehade minst hälften av röstetalet för samtliga aktier eller andra andelar i bolaget när noteringen skedde, och

2. sådana aktier eller andra andelar i fastighetsbolag som är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför EES och i vilka bolag fonden ensam eller tillsammans med någon eller några av de andra tre AP-fonderna innehade minst hälften av röstetalet för samtliga aktier eller andra andelar i bolaget när aktierna eller de andra andelarna togs upp till handel, och

180

3. andelar i svenska och utländska fonder som inte medför rätt att utöva rösträtt för de aktier eller andra andelar i företag som ingår i dessa fonder.

U

Denna lag träder i kraft den 1 november 2007.

181

2.29 Förslag till lag om ändring i lagen (2000:193) om Sjätte APfonden

Härigenom föreskrivs att 3 kap.5 och 6 §§ lagen (2000:193) om Sjätte AP-fonden skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

3 kap.

5 §

TPF

1

FPT

Om det behövs för en tillfredsställande betalningsberedskap eller för att tillgodose kravet på ändamålsenlig förvaltning, får fondmedel placeras hos Riksbanken, en bank, ett kreditmarknadsföretag eller postgirot. I samma syfte får fondmedel placeras i statsskuldväxlar, skattkammarväxlar, bankcertifikat, företagscertifikat samt andra värdepapper med hög likviditet, avsedda för den allmänna marknaden.

Om det behövs för en tillfredsställande betalningsberedskap eller för att tillgodose kravet på ändamålsenlig förvaltning, får fondmedel placeras hos Riksbanken, en bank eller ett kreditmarknadsföretag. I samma syfte får fondmedel placeras i statsskuldväxlar, skattkammarväxlar, bankcertifikat, företagscertifikat samt andra värdepapper med hög likviditet, avsedda för den allmänna marknaden.

6 §

Om det är uppenbart att Sjätte AP-fonden annars skulle lida en avsevärd förlust får fonden, i avsikt att skydda en fordran, på offentlig auktion eller på en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad köpa in egendom som är utmätt eller pantsatt för fordran eller överta egendom som betalning för fordran. Egendom som förvärvats på detta sätt skall avyttras så snart det är lämpligt och senast då det kan ske utan förlust.

Om det är uppenbart att Sjätte AP-fonden annars skulle lida en avsevärd förlust får fonden, i avsikt att skydda en fordran, på offentlig auktion eller på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet köpa in egendom som är utmätt eller pantsatt för fordran eller överta egendom som betalning för fordran. Egendom som förvärvats på detta sätt skall avyttras så snart det är lämpligt och senast då det kan ske utan förlust.

U

Denna lag träder i kraft den 1 november 2007.

TP

1

PT

Senaste lydelse 2004:439.

182

2.30 Förslag till lag om ändring i lagen (2000:562) om internationell rättslig hjälp i brottmål

Härigenom föreskrivs att 5 kap. 10 § lagen (2000:562) om internationell rättslig hjälp i brottmål skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

5 kap.

10 §

TPF

1

FPT

Bestämmelser om uppgiftsskyldighet finns i 26 j § lagen (1972:262) om understödsföreningar, 7 a kap. 10 a § försäkringsrörelselagen (1982:713), 1 kap. 8 a § lagen (1991:981) om värdepappersrörelse, 2 kap. 9 § lagen (1992:543) om börs- och clearingverksamhet, 8 kap. 2 a § lagen (1998:1479) om kontoföring av finansiella instrument, 4 kap. 5 § lagen (2002:149) om utgivning av elektroniska pengar, 2 kap. 20 § lagen (2004:46) om investeringsfonder, 1 kap. 11 § lagen (2004:297) om bank- och finansieringsrörelse, 6 kap. 8 § lagen (2006:531) om särskild tillsyn över finansiella konglomerat och 10 kap. 18 § lagen (2006:1371) om kapitaltäckning och stora exponeringar.

Bestämmelser om uppgiftsskyldighet finns i 26 j § lagen (1972:262) om understödsföreningar, 7 a kap. 10 a § försäkringsrörelselagen (1982:713), 8 kap. 2 a § lagen (1998:1479) om kontoföring av finansiella instrument, 4 kap. 5 § lagen (2002:149) om utgivning av elektroniska pengar, 2 kap. 20 § lagen (2004:46) om investeringsfonder, 1 kap. 11 § lagen (2004:297) om bank- och finansieringsrörelse, 6 kap. 8 § lagen (2006:531) om särskild tillsyn över finansiella konglomerat, 10 kap. 18 § lagen (2006:1371) om kapitaltäckning och stora exponeringar och 1 kap. 12 § lagen (2007:000) om värdepappersmarknaden.

I de lagar som anges i första stycket finns även bestämmelser om meddelandeförbud och ansvarsbestämmelser för den som bryter mot ett sådant förbud.

U

Denna lag träder i kraft den 1 november 2007.

TP

1

PT

Senaste lydelse 2006:1383.

183

2.31 Förslag till lag om ändring i lagen (2000:1087) om anmälningsskyldighet för vissa innehav av finansiella instrument

Härigenom föreskrivs att 1, 1 a, 6, 10 a, 12, 13 och 15 §§ lagen (2000:1087) om anmälningsskyldighet för vissa innehav av finansiella instrument skall ha följande lydelse.

Lydelse enligt prop. 2006/07:65 Föreslagen lydelse

1 §

I denna lag förstås med 1.

U

finansiellt instrument

U

: fond-

papper och annan rättighet eller förpliktelse avsedd för handel på värdepappersmarknaden,

1.

U

finansiellt instrument

U

: det som

anges i 1 kap. 4 § första stycket 1 lagen (2007:000) om värdepappersmarknaden,

2.

U

fondpapper

U

: aktie och obliga-

tion samt sådana andra delägarrätter eller fordringsrätter som är utgivna för allmän omsättning, fondandel och aktieägares rätt gentemot den som för hans räkning förvarar aktiebrev i ett utländskt bolag (depåbevis),

3.

U

värdepappersinstitut

U

: vad

som anges i 1 kap. 2 § 4 lagen (1991:981) om värdepappersrörelse,

2.

U

värdepappersinstitut

U

: det som

anges i 1 kap. 5 § 27 lagen om värdepappersmarknaden,

4.

U

börs

U

och auktoriserad mark-

nadsplats: vad som anges i 1 kap. 4 § 1 och 3 lagen (1992:543) om börs- och clearingverksamhet,

3.

U

börs

U

: det som anges i 1 kap.

5 § 3 lagen om värdepappersmarknaden och sådant utländskt företag som har tillstånd att driva en reglerad marknad från filial i Sverige,

5.

U

aktiemarknadsbolag

U

: svenskt

aktiebolag som utgivit aktier vilka är noterade vid en börs eller en auktoriserad marknadsplats,

4.

U

aktiemarknadsbolag

U

: svenskt

aktiebolag som gett ut aktier vilka är upptagna till handel på en reglerad marknad i Sverige,

6.

U

moder-

U

och

U

dotterföretag

U

: det

som anges i 1 kap.11 och 12 §§aktiebolagslagen (2005:551) om moderbolag och dotterföretag, varvid det som sägs om moderbolag skall tillämpas även på andra juridiska personer än aktiebolag,

5.

U

moder-

U

och

U

dotterföretag

U

: det

som anges i 1 kap.11 och 12 §§aktiebolagslagen (2005:551) om moderbolag och dotterföretag, varvid det som sägs om moderbolag skall tillämpas även på andra juridiska personer än aktiebolag,

7.

U

ordinarie delårsrapport

U

: del-

årsrapport samt förhandsmeddelande om kommande årsbokslut (bokslutskommuniké) som ett

6.

U

ordinarie delårsrapport

U

: del-

årsrapport samt förhandsmeddelande om kommande årsbokslut (bokslutskommuniké) som ett

184

aktiemarknadsbolag är skyldigt att lämna enligt sitt noteringsavtal med börsen eller den auktoriserade marknadsplatsen eller, om sådana bestämmelser saknas i noteringsavtalet, årsredovisning och delårsrapport enligt bestämmelserna i lagen om börs- och clearingverksamhet, årsredovisningslagen (1995:1554), lagen (1995:1559) om årsredovisning i kreditinstitut och värdepappersbolag eller lagen (1995:1560) om årsredovisning i försäkringsföretag samt delårsredogörelse enligt bestämmelserna i 5 a kap. 6 § lagen om börs- och clearingverksamhet, och

aktiemarknadsbolag är skyldigt att lämna enligt sitt noteringsavtal med börsen eller, om sådana bestämmelser saknas i noteringsavtalet, årsredovisning och delårsrapport enligt bestämmelserna i lagen om värdepappersmarknaden, årsredovisningslagen (1995:1554), lagen (1995:1559) om årsredovisning i kreditinstitut och värdepappersbolag eller lagen (1995:1560) om årsredovisning i försäkringsföretag samt delårsredogörelse enligt bestämmelserna i 16 kap. 6 § lagen om värdepappersmarknaden,

8.

U

insiderinformation

U

: informa-

tion om en icke offentliggjord eller inte allmänt känd omständighet som är ägnad att väsentligt påverka priset på finansiella instrument.

7.

U

insiderinformation

U

: informa-

tion om en icke offentliggjord eller inte allmänt känd omständighet som är ägnad att väsentligt påverka priset på finansiella instrument, och

8.

U

reglerad marknad

U

: det som

anges i 1 kap. 5 § 20 lagen om värdepappersmarknaden.

Om två juridiska personer äger så många aktier eller andelar i en annan svensk eller utländsk juridisk person att de har hälften var av rösterna för samtliga aktier eller andelar, är dock vid tillämpningen av denna lag de förstnämnda juridiska personerna att jämställa med moderföretag och den sistnämnda juridiska personen att jämställa med dotterföretag.

1 a §

Det som föreskrivs om aktiemarknadsbolag skall också tillämpas på

1. svenska aktiebolag som har gett ut aktier som är föremål för handel på en reglerad marknad i en annan stat inom Europeiska ekonomiska samarbetsområdet, och

2. utländska aktiebolag som har gett ut aktier som är noterade vid en börs eller en auktoriserad marknadsplats och som inte har sitt säte inom Europeiska ekonomiska samarbetsområdet, om bolagen är skyldiga att ge in dokument enligt 6 kap. 1 b § lagen (1991:980) om handel med finansiella instrument till Finansinspektionen.

2. utländska aktiebolag som har gett ut aktier som är upptagna till handel på en reglerad marknad i Sverige och som inte har sitt säte inom Europeiska ekonomiska samarbetsområdet, om bolagen är skyldiga att ge in dokument enligt 6 kap. 1 b § lagen (1991:980) om handel med finansiella instrument till Finansinspektionen.

185

Det som föreskrivs om fysiska personer som har insynsställning i aktiemarknadsbolag skall också tillämpas på fysiska personer som har insynsställning i bolag som avses i första stycket.

Nuvarande lydelse Föreslagen lydelse

6 §

TPF

1

FPT

Anmälan enligt 4 § om aktieinnehav eller ändring i innehavet skall ha kommit in till Finansinspektionen senast fem arbetsdagar efter det att

1. aktie i bolaget noterats vid en börs eller en auktoriserad marknadsplats,

1. aktie i bolaget tagits upp till handel på en reglerad marknad i Sverige,

2. insynsställning uppkommit enligt 3 § första stycket 1–4 eller 7 eller den som omfattas av 3 § första stycket 5 eller 6 tagit emot underrättelse enligt 7 eller 8 §,

3. den anmälningsskyldige ingått avtal om förvärv eller avyttring av aktier i bolaget eller annan ändring skett i aktieinnehavet, eller

4. den anmälningsskyldige fått vetskap om att närstående, som avses i 5 §, innehar eller har ingått avtal om förvärv eller avyttring av aktier i bolaget eller att annan ändring skett i den närståendes aktieinnehav.

10 a §

TPF

2

FPT

Ett svenskt aktiebolag som har gett ut fondpapper som har noterats vid en börs eller auktoriserad marknadsplats eller är föremål för handel på en reglerad marknad i en annan stat inom Europeiska ekonomiska samarbetsområdet, eller fondpapper för vilka en ansökan om sådan notering eller upptagande till handel har lämnats in, skall fortlöpande föra en förteckning över fysiska personer som på grund av anställning eller uppdrag arbetar för bolaget och som har tillgång till insiderinformation som rör bolaget. Förteckningen skall innehålla uppgift om anledningen till att personen tagits upp i den och datum då förteckningen senast uppdaterades.

Ett svenskt aktiebolag som har gett ut överlåtbara värdepapper enligt 1 kap. 4 § första stycket 2 a eller b lagen (2007:000) om värdepappersmarknaden som har tagits upp till handel på en reglerad marknad, eller sådana överlåtbara värdepapper för vilka en ansökan om upptagande till handel har lämnats in, skall fortlöpande föra en förteckning över fysiska personer som på grund av anställning eller uppdrag arbetar för bolaget och som har tillgång till insiderinformation som rör bolaget. Förteckningen skall innehålla uppgift om anledningen till att personen tagits upp i den och datum då förteckningen senast uppdaterades.

Förteckningen skall uppdateras så snart förhållandena ändras. Förteckningen skall sparas i minst fem år efter det att den upprättades eller, om den uppdaterats, efter det datum då den senast uppdaterades. Förteckningen skall på begäran lämnas till Finansinspektionen.

TP

1

PT

Senaste lydelse 2005:382.

TP

2

PT

Senaste lydelse 2005:382.

186

Bolaget skall se till att de personer som tas upp i förteckningen samtidigt skriftligen underrättas om vad detta innebär.

12 §

Den som är anställd eller uppdragstagare vid ett värdepappersinstitut, en börs eller en auktoriserad marknadsplats och som normalt kan antas ha tillgång till icke offentliggjord information om sådant förhållande som kan påverka kursen på finansiella instrument, skall till arbetsgivaren skriftligen anmäla innehav av finansiella instrument och ändring i innehavet.

Den som är anställd eller uppdragstagare vid ett värdepappersinstitut eller en börs och som normalt kan antas ha tillgång till icke offentliggjord information om förhållanden som kan påverka kursen på finansiella instrument, skall till arbetsgivaren skriftligen anmäla innehav av finansiella instrument och ändring i innehavet.

Vid tillämpningen av första stycket skall följande finansiella instrument likställas med den anmälningsskyldiges egna, nämligen sådana som ägs av

1. make eller sambo till den anmälningsskyldige,

2. omyndiga barn som står under den anmälningsskyldiges vårdnad.

13 §

Värdepappersinstitut, börs och auktoriserad marknadsplats skall föra förteckning över sådana anmälningar om innehav av finansiella instrument som gjorts enligt 12 §.

Värdepappersinstitut och börser skall föra förteckning över sådana anmälningar om innehav av finansiella instrument som gjorts enligt 12 §.

Om ett värdepappersinstitut, en börs eller en auktoriserad marknadsplats underlåter att föra en sådan förteckning som avses i första stycket, skall Finansinspektionen förelägga företaget att göra rättelse.

Om ett värdepappersinstitut eller en börs underlåter att föra en sådan förteckning som avses i första stycket, skall Finansinspektionen förelägga företaget att göra rättelse.

15 §

TPF

3

FPT

Den som enligt 3 § första stycket 1–3 har insynsställning i ett aktiemarknadsbolag får inför en ordinarie delårsrapport inte handla med aktier i bolaget under trettio dagar innan rapporten offentliggörs, dagen för offentliggörandet inkluderad.

Detsamma gäller för

1. fysiska och juridiska personer, vilkas aktier enligt 5 § skall likställas med aktier som innehas av personer som avses i första stycket, samt

2. aktiemarknadsbolags handel med egna aktier. Vad som sägs i andra stycket 2 skall inte tillämpas vid förvärv av egna aktier med stöd av 4 kap. 5 §

Det som sägs i andra stycket 2 skall inte tillämpas vid förvärv av egna aktier med stöd av 7 kap. 6 §

TP

3

PT

Senaste lydelse 2005:382.

187

lagen (1991:981) om värdepappersrörelse eller när en tidigare avyttring föreskrivs i lag.

lagen (2007:000) om värdepappersmarknaden eller när en tidigare avyttring föreskrivs i lag.

U

Denna lag träder i kraft den 1 november 2007.

188

2.32 Förslag till lag om ändring i lagen (2001:1227) om självdeklarationer och kontrolluppgifter

Härigenom föreskrivs att 10 kap.4, 8 och 11 §§ lagen (2001:1227) om självdeklarationer och kontrolluppgifter skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

10 kap.

4 §

TPF

1

FPT

Kontrolluppgift om annan avyttring än inlösen av andelar i en investeringsfond eller ett sådant fondföretag som avses i 1 kap. 7 eller

9 § lagen (2004:46) om investeringsfonder skall lämnas av förvaltare, om andelarna är förvaltarregistrerade.

Om en andel i ett fondföretag inte är förvaltarregistrerad skall kontrolluppgift lämnas av värdepappersinstitut i de fall dessa är skyldiga att upprätta avräkningsnota enligt 3 kap. 9 § lagen (1991:981) om värdepappersrörelse.

Om en andel i ett fondföretag inte är förvaltarregistrerad skall kontrolluppgift lämnas av värdepappersinstitut i de fall de medverkar vid avyttring av andelen.

8 §

Kontrolluppgift skall lämnas för fysiska personer och dödsbon av

1. värdepappersinstitut i de fall de är skyldiga att upprätta avräkningsnota enligt 3 kap. 9 § lagen (1991:981) om värdepappersrörelse,

1. värdepappersinstitut i de fall de medverkar vid avyttring av delägarrätt eller fordringsrätt och kontrolluppgift inte skall lämnas av dem som avses i 2–6,

2. värdepappersinstitut i de fall de registrerar en option eller en termin eller på annat sätt medverkar vid utfärdandet av optionen eller vid slutförandet av options- eller terminsaffären,

3. kreditmarknadsföretag,

4. Insättningsgarantinämnden,

5. den som har betalat ut ersättning vid avyttring genom inlösen, och

6. försäkringsgivare som har betalat ut ersättning på grund av sådan försäkring som avses i 5 kap. 2 § lagen om värdepappersrörelse.

6. försäkringsgivare som har betalat ut ersättning på grund av sådan försäkring som ett värdepappersbolag har tecknat för skadeståndsskyldighet som det kan komma att ådra sig när tjänster utförs i rörelsen.

11 §

Om delägarrätter eller fordringsrätter ägs gemensamt av flera personer och det upprättas en

Om delägarrätter eller fordringsrätter ägs gemensamt av flera personer och det upprättas en

TP

1

PT

Senaste lydelse 2004:72.

189

avräkningsnota vid avyttring, behöver kontrolluppgift lämnas endast för den som anges på avräkningsnotan.

rapport enligt 8 kap. 27 § lagen (2007:000) om värdepappersmarknaden vid avyttring, behöver kontrolluppgift lämnas endast för den kund som anges i rapporten.

U

1. Denna lag träder i kraft den 1 november 2007 och tillämpas första gången vid 2008 års taxering. 2. Äldre bestämmelser skall fortfarande tillämpas beträffande avyttringar som har gjorts före ikraftträdandet av denna lag.

190

2.33 Förslag till lag om ändring i lagen (2003:862) om finansiell rådgivning till konsumenter

Härigenom föreskrivs i fråga om lagen (2003:862) om finansiell rådgivning till konsumenter

dels att 2 § skall ha följande lydelse, dels att det i lagen skall införas en ny paragraf, 3 a §, av följande lydelse.

Nuvarande lydelse Föreslagen lydelse

2 §

I denna lag avses med konsument: en fysisk person som handlar huvudsakligen för ändamål som faller utanför näringsverksamhet,

näringsidkare: en fysisk eller juridisk person som handlar för ändamål som har samband med den egna näringsverksamheten,

U

finansiellt instrument

U

: fond-

papper och annan rättighet eller förpliktelse avsedd för handel på värdepappersmarknaden.

U

finansiellt instrument

U

: det som

anges i 1 kap. 4 § första stycket 1 lagen (2007:000) om värdepappersmarknaden.

3 a §

Bestämmelserna i 4 och 5 §§ gäller inte finansiell rådgivning som tillhandahålls av

1. fondbolag enligt 7 kap. 1 § första stycket 3 lagen (2004:46) om investeringsfonder,

2. försäkringsförmedlare enligt 5 kap. 1 § första stycket lagen (2005:405) om försäkringsförmedling, eller

3. värdepappersinstitut och utländska värdepappersföretag enligt lagen (2007:000) om värdepappersmarknaden.

U

1. Denna lag träder i kraft den 1 november 2007.

2. I fråga om rådgivning som har tillhandahållits före ikraftträdandet gäller äldre bestämmelser.

191

2.34 Förslag till lag om ändring i lagen (2003:1223) om utgivning av säkerställda obligationer

Härigenom föreskrivs att 1 kap. 2 § och 3 kap. 2 § lagen (2003:1223) om utgivning av säkerställda obligationer skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

1 kap.

2 §

TPF

1

FPT

I denna lag avses med emittentinstitut: en bank eller ett kreditmarknadsföretag som fått tillstånd enligt 2 kap. 1 § att ge ut säkerställda obligationer,

säkerställda obligationer: obligationer och andra jämförbara skuldförbindelser som är förenade med förmånsrätt i emittentinstitutets säkerhetsmassa,

fyllnadssäkerheter: tillgångar som enligt 3 kap. 2 § får ingå i säkerhetsmassan,

derivatavtal: avtal som träffats, i syfte att uppnå balans mellan finansiella villkor för tillgångar i säkerhetsmassan och motsvarande villkor för de säkerställda obligationerna, mellan ett emittentinstitut och

1. svenska staten, en svensk kommun eller därmed jämförlig samfällighet,

2. Europeiska gemenskaperna eller någon av de utländska stater eller centralbanker som framgår av föreskrifter meddelade med stöd av 6 kap. 3 § 1,

3. en sådan utländsk kommun eller därmed jämförlig samfällighet, med befogenhet att kräva in offentlig uppbörd, som framgår av föreskrifter meddelade med stöd av 6 kap. 3 § 1,

4. Sveriges allmänna hypoteksbank, ett kreditinstitut eller ett värdepappersbolag med tillstånd enligt 3 kap. 4 § första stycket 4 och 5 lagen (1991:981) om värdepappersrörelse,

4. Sveriges allmänna hypoteksbank, ett kreditinstitut eller ett värdepappersbolag med tillstånd enligt 2 kap. 2 § första stycket 2 och 8 lagen (2007:000) om värdepappersmarknaden,

5. en kommun eller därmed jämförlig samfällighet i någon av de utländska stater som framgår av föreskrifter meddelade med stöd av 6 kap. 3 § 1,

6. ett utländskt kreditinstitut i någon av de utländska stater som framgår av föreskrifter meddelade med stöd av 6 kap. 3 § 1,

7. de internationella utvecklingsbanker som framgår av föreskrifter meddelade med stöd av 6 kap. 3 § 1, eller

8. andra motparter som i enlighet med föreskrifter meddelade med stöd av 6 kap. 3 § 1 kan bedömas inte vara mer riskfyllda än de som anges i 1–7 och som uppfyller övriga krav som framgår av föreskrifterna,

säkerhetsmassa: krediter, fyllnadssäkerheter och i registret antecknade medel enligt 4 kap. 4 § i vilka obligationsinnehavarna och emittent-

TP

1

PT

Senaste lydelse 2006:1385.

192

institutets motparter i derivatavtal har förmånsrätt i enlighet med bestämmelserna i denna lag och förmånsrättslagen (1970:979),

bank: ett svenskt bankaktiebolag, en svensk sparbank eller en svensk medlemsbank, och

kreditmarknadsföretag: ett svenskt aktiebolag eller en svensk ekonomisk förening som har fått tillstånd att driva finansieringsrörelse enligt lagen (2004:297) om bank- och finansieringsrörelse.

3 kap.

2 §

TPF

2

FPT

I säkerhetsmassan får ingå fyllnadssäkerheter. Dessa får bestå av följande tillgångar:

1. inneliggande kassa, checkar och postremissväxlar,

2. placeringar och fordringar för vilka svenska staten, en svensk kommun eller därmed jämförlig samfällighet svarar,

3. placeringar och fordringar för vilka en utländsk stat eller centralbank svarar, om placeringen eller fordran gäller i den utländska statens valuta och är refinansierad i samma valuta,

4. övriga placeringar och fordringar för vilka Europeiska gemenskaperna eller någon av de utländska stater eller centralbanker som framgår av föreskrifter meddelade med stöd av 6 kap. 3 § 5 svarar,

5. placeringar och fordringar för vilka en sådan utländsk kommun eller därmed jämförlig samfällighet, med befogenhet att kräva in offentlig uppbörd, som framgår av föreskrifter meddelade med stöd av 6 kap. 3 § 5 svarar,

6. andra placeringar, fordringar, garantiförbindelser och åtaganden som i enlighet med föreskrifter meddelade med stöd av 6 kap. 3 § 5 kan bedömas inte vara mer riskfyllda än de som anges i 1–5, och

7. placeringar, fordringar, garantiförbindelser och andra åtaganden, för vilka säkerheten utgörs av sådana placeringar eller fordringar som anges i 1–6.

Finansinspektionen får efter ansökan besluta att även följande tillgångar får användas som fyllnadssäkerheter:

1. placeringar och fordringar för vilka Sveriges allmänna hypoteksbank, ett kreditinstitut eller ett värdepappersbolag med tillstånd enligt 3 kap. 4 § första stycket 4 och 5 lagen (1991:981) om värdepappersrörelse svarar,

1. placeringar och fordringar för vilka Sveriges allmänna hypoteksbank, ett kreditinstitut eller ett värdepappersbolag med tillstånd enligt 2 kap. 2 § första stycket 2 och 8 lagen (2007:000) om värdepappersmarknaden svarar,

2. placeringar och fordringar för vilka en kommun eller därmed jämförlig samfällighet i någon av de utländska stater som framgår av föreskrifter meddelade med stöd av 6 kap. 3 § 5 svarar,

3. placeringar och fordringar med en återstående löptid av högst ett år för vilka ett utländskt kreditinstitut svarar,

4. placeringar och fordringar för vilka ett utländskt kreditinstitut i någon av de utländska stater som framgår av föreskrifter meddelade med stöd av 6 kap. 3 § 5 svarar,

TP

2

PT

Senaste lydelse 2006:1385.

193

5. placeringar och fordringar för vilka någon av de internationella utvecklingsbanker som framgår av föreskrifter meddelade med stöd av 6 kap. 3 § 5 svarar,

6. andra placeringar, fordringar, garantiförbindelser och åtaganden som i enlighet med föreskrifter meddelade med stöd av 6 kap. 3 § 5 kan bedömas inte vara mer riskfyllda än de som anges i 1–5 och som uppfyller övriga krav som framgår av föreskrifterna, och

7. placeringar, fordringar, garantiförbindelser och andra åtaganden, för vilka säkerheten utgörs av sådana placeringar eller fordringar som anges i 1–6.

Fyllnadssäkerheterna får utgöra högst 20 procent av säkerhetsmassan. Om det finns särskilda skäl får Finansinspektionen i ett enskilt fall besluta att andelen under en begränsad tid får utgöra högst 30 procent.

U

Denna lag träder i kraft den 1 november 2007.

194

2.35 Förslag till lag om ändring i lagen (2004:46) om investeringsfonder

Härigenom föreskrivs i fråga om lagen (2004:46) om investeringsfonder

dels att 1 kap. 4 och 5 §§, 2 kap. 10, 10 a och 21 §§, 4 kap. 5 §, 5 kap. 3–5 §§, 7 kap. 1 §, 10 kap. 20 § och 11 kap. 1 § samt rubriken till 7 kap. skall ha följande lydelse,

dels att det i lagen skall införas en ny paragraf, 7 kap. 3 §, av följande lydelse.

Nuvarande lydelse Föreslagen lydelse

1 kap.

4 §

Ett svenskt aktiebolag får av Finansinspektionen ges tillstånd att driva fondverksamhet. Bolaget kan därutöver ges tillstånd att förvalta någon annans finansiella instrument och att utföra visst arbete eller vissa funktioner på uppdrag av ett fondbolag, ett förvaltningsbolag eller ett fondföretag.

Ett svenskt aktiebolag får av Finansinspektionen ges tillstånd att driva fondverksamhet. Bolaget kan därutöver ges tillstånd för diskretionär portföljförvaltning avseende finansiella instrument och att utföra visst arbete eller vissa funktioner på uppdrag av ett fondbolag, ett förvaltningsbolag eller ett fondföretag.

5 §

Tillstånd för fondverksamhet som avser specialfonder får ges av Finansinspektionen även till värdepappersbolag och svenska kreditinstitut som har tillstånd för förvaltning av någon annans finansiella instrument enligt 1 kap. 3 § första stycket 4 lagen (1991:981) om värdepappersrörelse.

Tillstånd för fondverksamhet som avser specialfonder får ges av Finansinspektionen även till värdepappersbolag och svenska kreditinstitut som har tillstånd för portföljförvaltning avseende finansiella instrument enligt 2 kap. 1 § 4 lagen (2007:000) om värdepappersmarknaden.

För sådan fondverksamhet som avses i första stycket skall bestämmelserna i

– 2 kap. 1 § 2, 5 och 6, 2 § tredje stycket, 7 § första stycket, 9 §, 17– 20 §§ och 21 § första stycket,

– 3 kap., – 4 kap., – 6 kap., – 8 kap., – 9 kap., samt – 10 kap. 1 § första stycket, 14 §, 19 §, 20 § första–tredje styckena och 21 § tillämpas.

Ett värdepappersbolag eller ett svenskt kreditinstitut får inleda sin fondverksamhet så snart tillstånd enligt första stycket har getts.

195

2 kap.

10 §

TPF

1

FPT

Ett fondbolag som förvaltar någon annans finansiella instrument skall för denna förvaltning och de tjänster enligt 7 kap. 1 § första stycket som bolaget utför ha det eventuella ytterligare kapital för kreditrisker, marknadsrisker och operativa risker som enligt lagen (2006:1371) om kapitaltäckning och stora exponeringar krävs av ett värdepappersbolag med motsvarande verksamhet.

Ett fondbolag som utför diskretionär portföljförvaltning avseende finansiella instrument skall för denna förvaltning och de tjänster enligt 7 kap. 1 § första stycket som bolaget utför ha det eventuella ytterligare kapital för kreditrisker, marknadsrisker och operativa risker som enligt lagen (2006:1371) om kapitaltäckning och stora exponeringar krävs av ett värdepappersbolag med motsvarande verksamhet.

10 a §

TPF

2

FPT

För ett fondbolag som förvaltar någon annans finansiella instrument tillämpas, utöver vad som följer av 10 §, även övriga bestämmelser i lagen (2006:1371) om kapitaltäckning och stora exponeringar som gäller för ett värdepappersbolag med motsvarande verksamhet.

För fondbolag som inte förvaltar någon annans finansiella instrument tillämpas de bestämmelser om finansiella företagsgrupper i 9 och 10 kap. lagen om kapitaltäckning och stora exponeringar som gäller för ett värdepappersbolag. Det som föreskrivs om kapitalkrav för fondbolag i 8, 9 och 11 §§ i detta kapitel skall då tillämpas även på en finansiell företagsgrupp.

För ett fondbolag som utför diskretionär portföljförvaltning avseende finansiella instrument tillämpas, utöver det som följer av 10 §, även övriga bestämmelser i lagen (2006:1371) om kapitaltäckning och stora exponeringar som gäller för ett värdepappersbolag med motsvarande verksamhet.

För fondbolag som inte utför diskretionär portföljförvaltning avseende finansiella instrument tillämpas de bestämmelser om finansiella företagsgrupper i 9 och 10 kap. lagen om kapitaltäckning och stora exponeringar som gäller för ett värdepappersbolag. Det som föreskrivs om kapitalkrav för fondbolag i 8, 9 och 11 §§ i detta kapitel skall då tillämpas även på en finansiell företagsgrupp.

När ett fondbolag är moderföretag i en finansiell företagsgrupp, skall den gruppbaserade redovisningen i 9 kap. 9 § lagen om kapitaltäckning och stora exponeringar upprättas med tillämpning av de regler som gäller för upprättandet av koncernbalansräkning och koncernresultaträkning enligt 7 kap. årsredovisningslagen (1995:1554). Detta gäller dock inte om något annat följer av lagen om kapitaltäckning och stora exponeringar eller föreskrifter meddelade med stöd av den lagen.

TP

1

PT

Senaste lydelse 2006:1386.

TP

2

PT

Senaste lydelse 2006:1386.

196

21 §

TPF

3

FPT

Om en fondandelsägare tillfogats skada genom att fondbolaget överträtt denna lag eller fondbestämmelserna, skall fondbolaget ersätta skadan. Om en fondandelsägare eller ett fondbolag tillfogats skada genom att förvaringsinstitutet överträtt denna lag eller fondbestämmelserna, skall institutet ersätta skadan.

Ett fondbolag som förvaltar någon annans finansiella instrument skall ha en sådan försäkring som anges i 5 kap. 2 § lagen (1991:981) om värdepappersrörelse för skadeståndsskyldighet som fondbolaget kan komma att dra på sig vid utförandet av sådan förvaltning och av eventuella tjänster enligt 7 kap. 1 § första stycket.

4 kap.

5 §

Omfattar ett uppdrag enligt 4 § att någon för fondbolagets räkning skall förvalta tillgångarna i en investeringsfond, skall avtalet innehålla riktlinjer för placering av fondmedlen. Fondbolaget skall tillförsäkra sig en rätt att regelbundet se över och vid behov ändra dessa riktlinjer.

Ett förvaltningsuppdrag får ges till 1. företag som står under Finansinspektionens tillsyn och som har fått inspektionens tillstånd att förvalta investeringsfonder eller någon annans finansiella instrument,

1. företag som står under Finansinspektionens tillsyn och som har fått inspektionens tillstånd att förvalta investeringsfonder eller att utföra diskretionär portföljförvaltning avseende finansiella instrument,

2. företag med säte i ett annat land inom EES, om företaget står under tillsyn av behörig myndighet i hemlandet och har tillstånd att driva verksamhet motsvarande den som avses i 1,

3. annat utländskt företag under förutsättning att

a) företaget står under tillsyn av behörig myndighet i hemlandet,

b) företaget har tillstånd att driva verksamhet motsvarande den som avses i 1, och

c) ett samarbete kan ske mellan Finansinspektionen och behörig myndighet i hemlandet.

5 kap.

3 §

Medel i en värdepappersfond får placeras i penningmarknadsinstrument som är, eller i fondpapper som är eller inom ett år från emissionen avses bli,

1. noterade vid en svensk eller 1. upptagna till handel på en

TP

3

PT

Ändringen innebär att andra stycket upphävs.

197

utländsk börs, reglerad marknad eller en motsvarande marknad utanför EES, eller

2. noterade vid en auktoriserad marknadsplats, eller

3. föremål för regelbunden handel vid någon annan reglerad marknad som är öppen för allmänheten.

2. föremål för regelbunden handel vid någon annan marknad som är reglerad och öppen för allmänheten.

En förutsättning för placeringar enligt första stycket är att börsen, marknadsplatsen eller marknaden finns angiven i fondbestämmelserna eller är godkänd av Finansinspektionen för sådana placeringar.

En förutsättning för placeringar enligt första stycket är att marknaden finns angiven i fondbestämmelserna eller är godkänd av Finansinspektionen för sådana placeringar.

4 §

Medel i en värdepappersfond får placeras i andra penningmarknadsinstrument än dem som anges i 3 § om reglerna för emissionen eller emittenten av instrumenten medför ett särskilt skydd för investeraren och det är instrument som

1. getts ut eller garanteras av en stat, av en delstat, av en central, regional eller lokal myndighet i ett land inom EES, av en centralbank i ett land inom EES, av Europeiska centralbanken, av Europeiska unionen, av Europeiska investeringsbanken eller av en mellanstatlig organisation i vilken en eller flera stater inom EES är medlemmar, eller

2. getts ut av ett företag vars finansiella instrument omsätts på en reglerad marknad som anges i 3 § första stycket, eller

2. getts ut av ett företag vars finansiella instrument omsätts på en marknad som anges i 3 § första stycket, eller

3. getts ut eller garanteras av ett organ som antingen är föremål för tillsyn i enlighet med de kriterier som fastställs i gemenskapslagstiftningen eller som omfattas av och följer sådana tillsynsregler som motsvarar dessa kriterier, eller

4. getts ut av ett bolag som tillhör de kategorier som godkänts av Finansinspektionen, förutsatt att investeringar i sådana instrument omfattas av ett skydd för investerarna som är likvärdigt med det som följer av punkterna 1–3 och som

a) har kapital och reserver som uppgår till ett belopp som motsvarar minst 10 miljoner euro och lägger fram och offentliggör redovisning i enlighet med rådets fjärde direktiv 78/660/EEG av den 25 juli 1978 grundat på artikel 54.3 g i fördraget om årsbokslut i vissa typer av bolag

TPF

4

FPT

, senast

ändrat genom Europaparlamentets

a) har kapital och reserver som uppgår till ett belopp som motsvarar minst 10 miljoner euro och lägger fram och offentliggör redovisning i enlighet med rådets fjärde direktiv 78/660/EEG av den 25 juli 1978 grundat på artikel 54.3 g i fördraget om årsbokslut i vissa typer av bolag

TPF

6

FPT

, senast

ändrat genom Europaparlamentets

TP

4

PT

EGT L 222, 14.8.1978, s. 11 (Celex 31978L0660).

198

och rådets direktiv 2001/65/EG

TPF

5

FPT

, och rådets direktiv 2006/46/EG

TPF

7

FPT

,

b) är en enhet, som inom en grupp företag som omfattar ett eller flera börsnoterade företag, ägnar sig åt gruppens finansiering, eller

b) är en enhet, som inom en grupp företag som omfattar ett eller flera företag som har gett ut aktier som är inregistrerade vid en reglerad marknad, ägnar sig åt gruppens finansiering, eller

c) är en enhet som ägnar sig åt att finansiera värdepapperisering som omfattas av kreditförstärkning från en bank.

5 §

I en värdepappersfond får det ingå andra fondpapper och penningmarknadsinstrument än de som anges i 3 och 4 §§, dock högst till 10 procent av fondens värde.

Om notering eller regelbunden handel enligt 3 § inte skett inom ett år från emissionen och de förvärvade instrumenten inte ryms inom gränsen enligt första stycket, skall de avyttras så snart det lämpligen kan ske. Skälig hänsyn skall då tas till fondandelsägarnas intressen.

Om upptagande till handel eller regelbunden handel enligt 3 § inte har skett inom ett år från emissionen och de förvärvade instrumenten inte ryms inom gränsen enligt första stycket, skall de avyttras så snart det lämpligen kan ske. Skälig hänsyn skall då tas till fondandelsägarnas intressen.

Om det i en fond ingår fondpapper som ännu inte är, men som inom ett år från emissionen avses bli, noterade eller föremål för regelbunden handel enligt 3 § eller sådana andra fondpapper och penningmarknadsinstrument som avses i första stycket, skall fondbolaget informera Finansinspektionen om detta, om värdet av dessa fondpapper och penningmarknadsinstrument överstiger 10 procent av fondens värde.

Om det i en fond ingår fondpapper som ännu inte är, men som inom ett år från emissionen avses bli, upptagna till handel eller föremål för regelbunden handel enligt 3 § eller sådana andra fondpapper och penningmarknadsinstrument som avses i första stycket, skall fondbolaget informera Finansinspektionen om detta, om värdet av dessa fondpapper och penningmarknadsinstrument överstiger 10 procent av fondens värde.

7 kap. Förvaltning av andras finansiella instrument

7 kap. Portföljförvaltning avseende finansiella instrument

1 §

Ett fondbolag som enligt 1 kap. 4 § har tillstånd att förvalta någon annans finansiella instrument får, efter tillstånd av Finansinspek-

Ett fondbolag som enligt 1 kap. 4 § har tillstånd för portföljförvaltning avseende finansiella instrument får, efter tillstånd av

TP

5

PT

EGT L 283, 27.10.2001, s. 28 (Celex 32001L0065).

TP

6

PT

EGT L 222, 14.8.1978, s. 11 (Celex 31978L0660).

TP

7

PT

EUT L 224, 16.8.2006, s. 1 (Celex 32006L0046).

199

tionen, som ett led i verksamheten Finansinspektionen, som ett led i verksamheten

1. ta emot fondandelar för förvaring, dock inte sådana fondandelar som ingår i en investeringsfond som förvaltas av fondbolaget,

2. ta emot medel med redovisningsskyldighet, och

3. lämna investeringsråd avseende sådana finansiella instrument som avses i 5 kap.

Medel som tas emot med redovisningsskyldighet enligt första stycket 2 skall genast avskiljas och sättas in på konto hos kreditinstitut.

Medel som tas emot med redovisningsskyldighet enligt första stycket 2 skall omedelbart avskiljas från bolagets egna tillgångar.

3 §

Ett fondbolag som utför diskretionär portföljförvaltning avseende finansiella instrument skall i denna förvaltning och när det utför tjänster enligt 1 § första stycket tillämpa bestämmelserna i 8 kap. 1, 9–12, 14, 21–23, 26, 27 och 34 §§ samt 35 § första stycket lagen (2007:000) om värdepappersmarknaden.

10 kap.

20 §

Tillstånd som enligt denna lag har lämnats ett fondbolag skall återkallas av Finansinspektionen om fondbolaget

1. inte inom ett år från beviljande av tillstånd har börjat driva sådan verksamhet som tillståndet avser,

2. har förklarat sig avstå från tillståndet,

3. under en sammanhängande tid av sex månader inte har drivit sådan verksamhet som tillståndet avser,

4. fått tillståndet genom att lämna falska uppgifter eller på något annat otillbörligt sätt,

5. inte längre uppfyller förutsättningarna för tillstånd, eller

6. genom att överträda en bestämmelse som avses i 19 § eller på annat sätt visat sig olämpligt att driva sådan verksamhet som tillståndet avser.

Om någon som ingår i fondbolagets ledning inte uppfyller de krav som ställs i denna lag, får tillståndet återkallas på den grunden bara om Finansinspektionen först beslutat att anmärka på att personen ingår i fondbolagets ledning och han eller hon, sedan en av inspektionen bestämd tid av högst tre månader gått, fortfarande finns kvar i ledningen.

Om fondbolagets egna medel understiger vad som föreskrivs i 2 kap. 8, 9 och 11 §§ får Finansinspektionen förelägga bolaget att inom tre månader täcka bristen eller upphöra med

Om fondbolagets egna medel understiger det som föreskrivs i 2 kap. 8, 9 och 11 §§ får Finansinspektionen förelägga bolaget att inom tre månader täcka bristen eller upphöra med

200

verksamheten. Motsvarande gäller om ett fondbolag som har tillstånd enligt 1 kap. 4 § att förvalta någon annans finansiella instrument inte uppfyller det kapitalkrav som anges i 2 kap. 10 §.

Har fondbolaget tillstånd för förvaltning av någon annans finansiella instrument, skall tillståndet för den verksamheten återkallas om bolaget inte har fullgjort sina skyldigheter enligt lagen (1999:158) om investerarskydd och inte har vidtagit rättelse inom ett år från det att Finansinspektionen har förelagt bolaget att fullgöra sina skyldigheter med upplysning att dess tillstånd annars kan komma att återkallas.

verksamheten. Motsvarande gäller om ett fondbolag som har tillstånd enligt 1 kap. 4 § för portföljförvaltning avseende finansiella instrument inte uppfyller det kapitalkrav som anges i 2 kap. 10 §.

Har fondbolaget tillstånd för portföljförvaltning avseende finansiella instrument, skall tillståndet för den verksamheten återkallas om bolaget inte har fullgjort sina skyldigheter enligt lagen (1999:158) om investerarskydd och inte har vidtagit rättelse inom ett år från det att Finansinspektionen har förelagt bolaget att fullgöra sina skyldigheter med upplysning att dess tillstånd annars kan komma att återkallas.

11 kap.

1 §

Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om

1. vilka poster som får räknas in i startkapitalet enligt 2 kap. 4 §,

2. vilka poster som får räknas in i egna medel enligt 2 kap. 8, 9 och 11 §§,

3. vilka sundhetskrav som skall uppfyllas av ett fondbolag enligt 2 kap. 17 §,

4. sådan försäkring för skadeståndsskyldighet som ett fondbolag som förvaltar någon annans finansiella instrument skall ha enligt 2 kap. 21 § andra stycket,

5. vilka derivatinstrument ett fondbolag får använda enligt 5 kap. 1 § tredje stycket samt villkor och gränser för sådan användning,

6. hur beräkning och redovisning av en specialfonds risknivå skall utföras enligt 6 kap. 3 §,

4. vilka derivatinstrument ett fondbolag får använda enligt 5 kap. 1 § tredje stycket samt villkor och gränser för sådan användning,

5. hur beräkning och redovisning av en specialfonds risknivå skall utföras enligt 6 kap. 3 §,

6. vilka åtgärder som ett fondbolag skall vidta om det tar emot medel med redovisningsskyldighet enligt 7 kap. 1 §,

7. vilka åtgärder som ett fondbolag skall vidta för att uppfylla de krav som följer av bestämmel-

201

7. vilka upplysningar som fondbolag, förvaltningsbolag, fondföretag samt förvaringsinstitut skall lämna till Finansinspektionen för dess tillsynsverksamhet, samt

8. sådana avgifter för tillsyn som avses i 10 kap. 1 § andra stycket.

serna i 7 kap. 3 §,

8. vilka upplysningar som fondbolag, förvaltningsbolag, fondföretag samt förvaringsinstitut skall lämna till Finansinspektionen för dess tillsynsverksamhet, samt

9. sådana avgifter för tillsyn som avses i 10 kap. 1 § andra stycket.

U

1. Denna lag träder i kraft den 1 november 2007.

2. Fondbolag som vid ikraftträdandet av denna lag har tillstånd att förvalta någon annans finansiella instrument enligt 1 kap. 4 § skall anses ha tillstånd för portföljförvaltning avseende finansiella instrument enligt samma paragraf och att lämna investeringsråd enligt 7 kap. 1 § första stycket 3.

202

2.36 Förslag till lag om ändring i lagen (2004:297) om bank- och finansieringsrörelse

Härigenom föreskrivs att 1 kap. 5 §, 4 kap. 7 §, 6 kap. 7 § samt 7 kap.1 och 3 §§ lagen (2004:297) om bank- och finansieringsrörelse skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

1 kap.

5 §

TPF

1

FPT

I denna lag betyder

1. anknutet företag: ett svenskt eller utländskt företag vars huvudsakliga verksamhet består i att äga eller förvalta fast egendom, tillhandahålla datatjänster eller driva annan liknande verksamhet som har samband med den huvudsakliga verksamheten i ett eller flera kreditinstitut, värdepappersbolag, institut för elektroniska pengar eller motsvarande utländska företag,

2. bank: bankaktiebolag, sparbank och medlemsbank,

3. bankaktiebolag: ett aktiebolag som har fått tillstånd att driva bankrörelse,

4. behörig myndighet: en utländsk myndighet som har behörighet att utöva tillsyn över utländska kreditinstitut,

5. EES: Europeiska ekonomiska samarbetsområdet,

6. filial: ett avdelningskontor med självständig förvaltning, varvid även ett utländskt kreditinstituts etablering av flera driftställen skall anses som en enda filial,

7. finansiellt institut: ett företag som inte är kreditinstitut, värdepappersbolag, institut för elektroniska pengar eller motsvarande utländskt företag och vars huvudsakliga verksamhet är att

a) förvärva eller inneha aktier eller andelar,

b) driva värdepappersrörelse utan att vara tillståndspliktigt enligt 1 kap. 3 § lagen (1991:981) om värdepappersrörelse, eller

b) driva värdepappersrörelse utan att vara tillståndspliktigt enligt 2 kap. 1 § lagen (2007:000) om värdepappersmarknaden, eller

c) driva en eller flera av de verksamheter som anges i 7 kap. 1 § andra stycket 2–10 och 12 utan att vara tillståndspliktigt enligt 2 kap. 1 §,

8. hemland: det land där ett företag har fått tillstånd till rörelse som avses i denna lag,

9. kapitalbas: detsamma som i 3 kap. lagen (2006:1371) om kapitaltäckning och stora exponeringar,

10. kreditinstitut: bank och kreditmarknadsföretag, 11. kreditmarknadsbolag: ett aktiebolag som har fått tillstånd att driva finansieringsrörelse,

12. kreditmarknadsförening: en ekonomisk förening som har fått tillstånd att driva finansieringsrörelse,

13. kreditmarknadsföretag: kreditmarknadsbolag och kreditmarknadsförening,

TP

1

PT

Senaste lydelse 2006:1387.

203

14. kvalificerat innehav: ett direkt eller indirekt ägande i ett företag, om innehavet representerar tio procent eller mer av kapitalet eller av samtliga röster eller annars möjliggör ett väsentligt inflytande över ledningen av företaget,

15. medlemsbank: en ekonomisk förening som avses i lagen (1995:1570) om medlemsbanker,

16. sparbank: ett företag som avses i sparbankslagen (1987:619), 17. startkapital: det kapital som definieras i artikel 57 a och b i Europaparlamentets och rådets direktiv 2006/48/EG av den 14 juni 2006 om rätten att starta och driva verksamhet i kreditinstitut (omarbetning)

TPF

2

FPT

,

18. utländskt bankföretag: ett utländskt företag som i hemlandet har tillstånd att driva bankrörelse,

19. utländskt kreditföretag: ett utländskt företag som i hemlandet har tillstånd att driva finansieringsrörelse, och

20. utländskt kreditinstitut: ett utländskt bankföretag och ett utländskt kreditföretag.

4 kap.

7 §

Ett utländskt kreditinstitut som driver rörelse med stöd av 1, 2 eller 4 § får här driva bara sådan verksamhet som omfattas av institutets verksamhetstillstånd i hemlandet.

Ett utländskt företag som avses i 3 § får här driva bara sådan verksamhet som är tillåten enligt företagets bolagsordning eller stadgar och bara i den utsträckning det eller de utländska kreditinstitut som äger företaget eller dess moderföretag skulle ha rätt enligt första stycket att driva sådan verksamhet.

I 1 kap.3 d och 3 e §§ lagen (1991:981) om värdepappersrörelse finns bestämmelser om att verksamhet som avses i 1 kap. 3 § samma lag under vissa förutsättningar får drivas av utländska kreditinstitut som driver verksamhet med stöd av 1 och 2 §§ och av finansiella institut och dotterföretag som driver verksamhet med stöd av 3 §.

I 4 kap. 2 § 2 och 3 lagen (2007:000) om värdepappersmarknaden finns bestämmelser om att verksamhet som avses i 2 kap. 1 § samma lag under vissa förutsättningar får drivas av utländska kreditinstitut som driver verksamhet med stöd av 1 och 2 §§ och av finansiella institut och dotterföretag som driver verksamhet med stöd av 3 §.

6 kap.

7 §

Om ett kreditinstitut vill uppdra åt någon annan att utföra någon av de tjänster som avses i 7 kap. 1 §, skall institutet anmäla detta till Finansinspektionen och ge in uppdragsavtalet. Ett sådant uppdrag får ges om

1. institutet svarar för den anförtrodda verksamheten mot kunden,

2. verksamheten drivs av uppdragstagaren under kontrollerade och säkerhetsmässigt betryggande former, och

TP

2

PT

EUT L 177, 30.6.2006, s. 1 (Celex 32006L0048).

204

3. uppdraget inte har sådan omfattning att institutet inte kan uppfylla de skyldigheter som följer av denna lag eller andra författningar som reglerar institutets verksamhet.

Första stycket gäller inte uppdrag åt någon annan att driva värdepappersrörelse. I fråga om värdepappersrörelse gäller i stället bestämmelserna i 8 kap. 14 § lagen (2007:000) om värdepappersmarknaden.

7 kap.

1 §

Ett kreditinstitut får driva bara finansiell verksamhet och verksamhet som har ett naturligt samband med den.

Ett kreditinstitut får i sin verksamhet, bland annat

1. låna upp medel, till exempel genom att ta emot inlåning från allmänheten eller ge ut obligationer eller andra jämförbara fordringsrätter,

2. lämna och förmedla kredit, till exempel i form av konsumentkredit och kredit mot panträtt i fast egendom eller fordringar,

3. medverka vid finansiering, till exempel genom att förvärva fordringar och upplåta lös egendom till nyttjande (leasing),

4. förmedla betalningar,

5. tillhandahålla betalningsmedel,

6. ikläda sig garantiförbindelser och göra liknande åtaganden,

7. medverka vid värdepappersemissioner,

8. lämna ekonomisk rådgivning,

9. förvara värdepapper, 10. driva rembursverksamhet, 11. tillhandahålla värdefackstjänster, 12. driva valutahandel, 13. driva värdepappersrörelse under de förutsättningar som föreskrivs i lagen (1991:981) om värdepappersrörelse, samt

13. driva värdepappersrörelse under de förutsättningar som föreskrivs i lagen (2007:000) om värdepappersmarknaden, samt

14. lämna kreditupplysning under de förutsättningar som föreskrivs i kreditupplysningslagen (1973:1173).

3 §

För att skydda en fordran får ett kreditinstitut 1. på offentlig auktion, en svensk eller utländsk börs eller en auktoriserad marknadsplats eller någon annan reglerad marknad eller vid exekutiv försäljning köpa egendom som är utmätt eller utgör säkerhet för fordran, och

1. på offentlig auktion, på en reglerad marknad eller en motsvarande marknad utanför EES, på en handelsplattform enligt 1 kap. 5 § 12 lagen (2007:000) om värdepappersmarknaden eller vid exekutiv försäljning köpa egendom som är utmätt eller utgör säkerhet för fordran, och

205

2. om det finns skäl att anta att institutet annars skulle lida avsevärd förlust, som betalning för en fordran överta egendom som utgör säkerhet för fordran eller annan egendom.

U

Denna lag träder i kraft den 1 november 2007.

206

2.37 Förslag till lag om ändring i lagen (2005:377) om straff för marknadsmissbruk vid handel med finansiella instrument

Härigenom föreskrivs att 1, 5, 6, 10 och 18 §§ lagen (2005:377) om straff för marknadsmissbruk vid handel med finansiella instrument skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

1 §

I denna lag förstås med

1. insiderinformation: information om en icke offentliggjord eller inte allmänt känd omständighet som är ägnad att väsentligt påverka priset på finansiella instrument,

2.

U

handel på värdepappers-

marknaden

U

: handel på börs eller

någon annan organiserad marknadsplats eller handel med eller genom någon som yrkesmässigt bedriver sådan verksamhet som avses i 1 kap. 3 § första stycket lagen (1991:981) om värdepappersrörelse,

2.

U

handel på värdepappers-

marknaden

U

: handel på en reglerad

marknad eller någon annan organiserad marknadsplats eller handel med eller genom någon som yrkesmässigt bedriver sådan verksamhet som avses i 2 kap. 1 § lagen (2007:000) om värdepappersmarknaden,

3.

U

finansiellt instrument

U

: fond-

papper och annan rättighet eller förpliktelse avsedd för handel på värdepappersmarknaden,

3.

U

finansiellt instrument

U

: det som

anges i 1 kap. 4 § första stycket 1 lagen om värdepappersmarknaden, och

4.

U

fondpapper

U

: aktie och

obligation samt sådana andra delägarrätter eller fordringsrätter som är utgivna för allmän omsättning, fondandel och aktieägares rätt gentemot den som för hans eller hennes räkning förvarar aktiebrev i ett utländskt bolag (depåbevis).

4.

U

reglerad marknad

U

: det som

anges i 1 kap. 5 § 20 lagen om värdepappersmarknaden.

5 §

Trots bestämmelserna i 2–4 §§ får

1. befattningshavare hos företag som driver värdepappersrörelse med stöd av 1 kap. 3, 3 c eller 3 d § lagen (1991:981) om värdepappersrörelse fullgöra uppdrag som lämnats företaget att förvärva eller avyttra finansiella instrument samt, utan användande av insiderinformation, fullgöra verksamhet som följer av avtal om att

1. befattningshavare hos företag som driver värdepappersrörelse med stöd av 2 kap. 1 § eller 4 kap. 1 eller 2 § lagen (2007:000) om värdepappersmarknaden fullgöra uppdrag som lämnats företaget att förvärva eller avyttra finansiella instrument samt, utan att använda insiderinformation, fullgöra verksamhet som följer av avtal om att

207

upprätthålla en marknad i ett eller flera finansiella instrument eller att fullgöra uppdrag om rådgivning eller förvaltning,

upprätthålla en marknad i ett eller flera finansiella instrument eller att fullgöra uppdrag om rådgivning eller förvaltning,

2. finansiellt instrument förvärvas när insiderinformationen är ägnad att sänka priset på instrumentet och avyttras när informationen är ägnad att höja priset på instrumentet,

3. uppgifter fullgöras som någon har på grund av vad som föreskrivits i lag eller annan författning,

4. aktier i ett aktiebolag eller ett europabolag förvärvas för en fysisk eller juridisk persons räkning, om insiderinformationen endast utgörs av information om en åtgärd som syftar till och är ägnad att leda till ett offentligt erbjudande av den personen till en vidare krets om förvärv av aktier i bolaget,

5. den som innehar en option som har ett ekonomiskt värde vid löptidens slut avyttra optionen eller utnyttja den enligt dess villkor,

6. den som utfärdar en option i samband med lösen avyttra eller förvärva den underliggande tillgång som optionen avser,

7. ingångna terminskontrakt fullgöras på slutdagen,

8. den som innehar en tilldelad emissionsrätt eller inlösenrätt som har ett ekonomiskt värde avyttra rätten eller utnyttja den enligt dess villkor,

9. andra finansiella instrument än aktier förvärvas eller avyttras, om förvärvet eller avyttringen sker utan att insiderinformation används.

Det som föreskrivs om aktie i första stycket 4 och 9 skall också tillämpas på aktierelaterade finansiella instrument såsom teckningsrätt, interimsbevis, optionsbevis, konvertibelt skuldebrev, skuldebrev förenat med optionsrätt till nyteckning, vinstandelsbevis, aktieoption och aktietermin.

6 §

Bestämmelserna i 2–5 §§ skall även tillämpas på förfaranden enligt dessa bestämmelser som inte utgör eller föranleder handel på värdepappersmarknaden, om förfarandena avser finansiella instrument

1. som är godkända för handel på en reglerad marknad i en medlemsstat inom Europeiska ekonomiska samarbetsområdet,

1. som är upptagna till handel på en reglerad marknad,

2. för vilka en ansökan om godkännande enligt 1 har lämnats in, eller

2. för vilka en ansökan om upptagande till handel enligt 1 har lämnats in, eller

3. vilkas värde är beroende av ett finansiellt instrument enligt 1 eller 2.

10 §

Värdepappersinstitut enligt lagen (1991:981) om värdepappersrörelse, börser och auktoriserade marknadsplatser enligt lagen (1992:543) om börs- och clearingverksamhet samt kreditinstitut enligt lagen (2004:297) om bank- och

Värdepappersinstitut och börser enligt lagen (2007:000) om värdepappersmarknaden och sådana utländska företag som har tillstånd enligt samma lag att driva en reglerad marknad från filial i Sverige samt kreditinstitut enligt lagen (2004:297) om bank-

208

finansieringsrörelse skall snarast rapportera till Finansinspektionen, om det kan antas att en transaktion utgör eller har samband med insiderbrott eller otillbörlig marknadspåverkan. Inspektionen skall snarast överlämna uppgifterna till åklagare.

och finansieringsrörelse skall snarast rapportera till Finansinspektionen, om det kan antas att en transaktion utgör eller har samband med insiderbrott eller otillbörlig marknadspåverkan. Inspektionen skall snarast överlämna uppgifterna till åklagare.

18 §

Finansinspektionen skall fortlöpande bedöma om den praxis som tillämpas vid handel på börser och auktoriserade marknadsplatser är godtagbar och offentliggöra sina beslut om godtagande av praxis.

Finansinspektionen skall fortlöpande bedöma om den praxis som tillämpas vid handel på reglerade marknader i Sverige är godtagbar och offentliggöra sina beslut om godtagande av praxis.

U

Denna lag träder i kraft den 1 november 2007.

209

2.38 Förslag till lag om ändring i lagen (2005:405) om försäkringsförmedling

Härigenom föreskrivs att 1 kap. 5 §, 5 kap.1, 4 och 5 §§ samt 8 kap.6 och 13 §§ lagen (2005:405) om försäkringsförmedling skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

1 kap.

5 §

När en försäkringsförmedlare utövar sådan sidoverksamhet som avses i 1 kap. 3 b § lagen (1991:981) om värdepappersrörelse, är lagen tillämplig även på denna verksamhet, om inte något annat sägs.

När en försäkringsförmedlare utövar sådan sidoverksamhet som avses i 2 kap. 5 § första stycket 15 lagen (2007:000) om värdepappersmarknaden, är lagen tillämplig även på denna verksamhet, om inte något annat sägs.

5 kap.

1 §

En försäkringsförmedlare får efter tillstånd av Finansinspektionen utöva sådan sidoverksamhet som avses i 1 kap. 3 b § lagen (1991:981) om värdepappersrörelse.

En försäkringsförmedlare får efter tillstånd av Finansinspektionen utöva sådan sidoverksamhet som avses i 2 kap. 5 § första stycket 15 lagen (2007:000) om värdepappersmarknaden.

Vid prövning av en ansökan om tillstånd enligt första stycket gäller bestämmelserna i 2 kap. 5 eller 6 § i tillämpliga delar.

4 §

Försäkringsförmedlaren skall i sin verksamhet iaktta god försäkringsförmedlingssed och med tillbörlig omsorg ta till vara kundens intressen.

Försäkringsförmedlaren skall anpassa sin rådgivning efter kundens önskemål och behov samt rekommendera lösningar som är lämpliga för kunden. Om försäkringsförmedlaren har informerat kunden enligt 6 kap. 2 § första stycket 1 om att han eller hon lämnar rådgivning om försäkring på grundval av en opartisk analys, är förmedlaren skyldig att lämna rådgivningen efter en analys av ett tillräckligt stort antal försäkringsavtal på marknaden.

Förmedlaren skall avråda en kund som är en fysisk person som handlar huvudsakligen för ändamål som faller utanför näringsverksamhet från att vidta åtgärder som inte kan anses lämpliga med hänsyn till personens behov, ekonomiska förhållanden eller andra omständigheter.

Om försäkringsförmedlaren utövar sådan sidoverksamhet som avses i 1 § första stycket, gäller dessutom bestämmelserna i 1 kap. 7 § lagen (1991:981) om värde-

Om försäkringsförmedlaren utövar sådan sidoverksamhet som avses i 1 § första stycket, gäller dessutom bestämmelserna i 8 kap. lagen (2007:000) om värdepap-

210

pappersrörelse för den verksamheten.

persmarknaden för den verksamheten i tillämpliga delar.

5 §

Pengar och andra tillgångar som försäkringsförmedlaren får hand om för kundens räkning skall hållas avskilda från egna tillgångar.

Om försäkringsförmedlaren utövar sådan sidoverksamhet som avses i 1 § första stycket, gäller i stället bestämmelserna i 1 kap. 3 b § 3 lagen (1991:981) om värdepappersrörelse för den verksamheten.

Om försäkringsförmedlaren utövar sådan sidoverksamhet som avses i 1 § första stycket, gäller i stället bestämmelserna i 2 kap. 5 § första stycket 15 c lagen (2007:000) om värdepappersmarknaden för den verksamheten.

8 kap.

6 §

Om Finansinspektionen har återkallat tillståndet för en försäkringsförmedlare, skall inspektionen snarast underrätta Bolagsverket om detta.

Om Bolagsverket har återkallat registreringen avseende förmedling av livförsäkring eller alla slag av försäkring för en anknuten försäkringsförmedlare som har tillstånd att utöva sådan sidoverksamhet som avses i 1 kap. 3 b § lagen (1991:981) om värdepappersrörelse, skall Bolagsverket snarast underrätta Finansinspektionen om detta.

Om Bolagsverket har återkallat registreringen avseende förmedling av livförsäkring eller alla slag av försäkring för en anknuten försäkringsförmedlare som har tillstånd att utöva sådan sidoverksamhet som avses i 2 kap. 5 § första stycket 15 lagen (2007:000) om värdepappersmarknaden, skall Bolagsverket snarast underrätta Finansinspektionen om detta.

13 §

Straffavgiften skall fastställas till lägst fem tusen kronor och högst femtio miljoner kronor.

Straffavgiften skall uppgå till lägst 5 000 kronor och högst 50 miljoner kronor.

Avgiften får inte överstiga tio procent av omsättningen närmast föregående räkenskapsår för försäkringsförmedlaren, försäkringsföretaget eller filialen till en sådan utländsk försäkringsförmedlare som avses i 3 kap. 2 §. Om överträdelsen har skett under försäkringsförmedlarens, försäkringsföretagets eller filialens första verksamhetsår eller om uppgifter om omsättningen annars saknas eller är bristfälliga, får den uppskattas.

Avgiften får inte vara så stor att försäkringsförmedlaren eller försäkringsföretaget därefter inte uppfyller kraven i 6 kap. 1 § lagen (2004:297) om bank- och finansieringsrörelse eller 1 kap. 1 a § första stycket försäkringsrörelselagen (1982:713).

Avgiften får inte vara så stor att försäkringsförmedlaren eller försäkringsföretaget därefter inte uppfyller kraven i 8 kap. 3 § lagen (2007:000) om värdepappersmarknaden, 6 kap. 1 § lagen (2004:297) om bank- och finansieringsrörelse eller 1 kap. 1 a § första stycket försäkringsrörelse-

211

lagen (1982:713).

När avgiftens storlek fastställs, skall särskild hänsyn tas till hur allvarlig den överträdelse är som har föranlett anmärkningen eller varningen och hur länge överträdelsen har pågått.

När avgiftens storlek beslutas, skall särskild hänsyn tas till hur allvarlig den överträdelse är som har föranlett anmärkningen eller varningen och hur länge överträdelsen har pågått.

U

Denna lag träder i kraft den 1 november 2007.

212

2.39 Förslag till lag om ändring i aktiebolagslagen (2005:551)

Härigenom föreskrivs i fråga om aktiebolagslagen (2005:551) dels att 1 kap. 8 §, 2 kap. 29 §, 4 kap. 47 §, 7 kap. 54 a och 61–64 §§, 8 kap. 51 §, 9 kap. 13 §, 13 kap. 4 och 5 §§, 14 kap. 5 §, 15 kap. 5 §, 19 kap. 13, 14, 32 och 36 §§, 20 kap. 10 §, 22 kap. 2 § samt rubriken närmast före 19 kap. 32 § skall ha följande lydelse,

dels att rubriken närmast före 19 kap. 35 § skall lyda ”Överlåtelse av egna aktier som inte sker på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet”.

Nuvarande lydelse Föreslagen lydelse

1 kap.

8 §

Sådana värdepapper som anges i 7 § får, så länge bolaget är privat, inte bli föremål för handel på en svensk eller utländsk börs eller någon annan organiserad marknadsplats.

Sådana värdepapper som anges i 7 § får, så länge bolaget är privat, inte bli föremål för handel på en reglerad marknad, en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet eller någon annan organiserad marknadsplats.

2 kap.

29 §

Om ett publikt aktiebolag inom två år från registreringen i aktiebolags registret träffar avtal med en stiftare eller en aktieägare, som innebär att bolaget förvärvar egendom mot en ersättning som motsvarar minst en tiondel av aktiekapitalet, skall styrelsen inom sex månader underställa bolagsstämman avtalet för godkännande. Det gäller dock inte om förvärvet sker på en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad eller som ett led i bolagets löpande affärsverksamhet.

Om ett publikt aktiebolag inom två år från registreringen i aktiebolagsregistret träffar avtal med en stiftare eller en aktieägare, som innebär att bolaget förvärvar egendom mot en ersättning som motsvarar minst en tiondel av aktiekapitalet, skall styrelsen inom sex månader underställa bolagsstämman avtalet för godkännande. Det gäller dock inte om förvärvet sker på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet eller som ett led i bolagets löpande affärsverksamhet.

Lydelse enligt prop. 2006/07:70 Föreslagen lydelse

4 kap.

47 §

Ett beslut om uppdelning eller sammanläggning av aktier är giltigt endast om samtycke har lämnats av

213

1. samtliga aktieägare som på dagen för bolagsstämman eller, i avstämningsbolag, på den dag som avses i 7 kap. 28 § tredje stycket är införda i aktieboken som ägare till aktier av visst slag som inte motsvarar ett helt antal nya aktier (överskjutande aktier), och

2. i fråga om överskjutande aktier som är förvaltarregistrerade och som på den dag som avses i punkten 1 inte är införda i aktieboken, förvaltaren.

2. i fråga om överskjutande aktier som är förvaltarregistrerade och vars ägare på den dag som avses i 1 inte är införda i aktieboken, förvaltaren.

Samtycke enligt första stycket krävs inte av aktieägare vars samtliga överskjutande aktier är föremål för handel på en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad. Samtycke krävs inte heller av förvaltare, om samtliga överskjutande aktier som omfattas av förvaltningen är föremål för sådan handel.

Samtycke enligt första stycket krävs inte av aktieägare vars samtliga överskjutande aktier är föremål för handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet. Samtycke krävs inte heller av förvaltare, om samtliga överskjutande aktier som omfattas av förvaltningen är föremål för sådan handel.

Lydelse enligt prop. 2006/07:65 Föreslagen lydelse

7 kap.

54 a §

Ett publikt aktiebolag, vars aktier är noterade vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad, skall inför en bolagsstämma tillhandahålla aktieägarna ett fullmaktsformulär.

Ett publikt aktiebolag, vars aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet, skall inför en bolagsstämma tillhandahålla aktieägarna ett fullmaktsformulär.

Formuläret skall tillhandahållas tillsammans med kallelsen till bolagsstämman, om kallelsen sänds till aktieägarna. Om kallelse sker på något annat sätt, skall fullmaktsformuläret tillhandahållas aktieägarna på begäran efter det att bolagsstämman har tillkännagetts.

Formuläret får inte innehålla namn på ombud eller ange hur ombudet skall rösta.

Bestämmelserna i denna paragraf hindrar inte bolaget att tillhandahålla sådana fullmaktsformulär som avses i 4 §.

Nuvarande lydelse Föreslagen lydelse

61 §

TPF

1

FPT

I ett aktiebolag, vars aktier är noterade vid en börs eller en auktoriserad marknadsplats, skall

I ett aktiebolag, vars aktier är upptagna till handel på en reglerad marknad i Sverige, skall

TP

1

PT

Senaste lydelse 2006:562.

214

det vid årsstämman fattas beslut om riktlinjer för ersättning till ledande befattningshavare. Riktlinjerna skall ha det innehåll som anges i 8 kap. 51 § första stycket och 52 § första stycket.

det vid årsstämman fattas beslut om riktlinjer för ersättning till ledande befattningshavare. Riktlinjerna skall ha det innehåll som anges i 8 kap. 51 § första stycket och 52 § första stycket.

62 §

TPF

2

FPT

I ett aktiebolag, vars aktier är noterade vid en börs eller en auktoriserad marknadsplats, skall vad som sägs i 25 § även gälla revisorns yttrande enligt 8 kap. 54 §.

I ett aktiebolag, vars aktier är upptagna till handel på en reglerad marknad i Sverige, skall det som sägs i 25 § även gälla revisorns yttrande enligt 8 kap. 54 §.

Lydelse enligt prop. 2006/07:65 Föreslagen lydelse

63 §

I ett publikt aktiebolag vars aktier är noterade vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad, skall en kallelse till en bolagsstämma, utöver det som anges i 24 §, även innehålla uppgift om det totala antalet aktier och röster i bolaget. Uppgifterna skall avse förhållandena vid tidpunkten för bolagsstämman eller, i fråga om avstämningsbolag, vid den tidpunkt som anges i 28 § tredje stycket. Om detta inte är möjligt, skall uppgifterna avse förhållandena vid den tidpunkt då kallelsen utfärdades.

I ett publikt aktiebolag vars aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet, skall en kallelse till en bolagsstämma, utöver det som anges i 24 §, även innehålla uppgift om det totala antalet aktier och röster i bolaget. Uppgifterna skall avse förhållandena vid tidpunkten för bolagsstämman eller, i fråga om avstämningsbolag, vid den tidpunkt som anges i 28 § tredje stycket. Om detta inte är möjligt, skall uppgifterna avse förhållandena vid den tidpunkt då kallelsen utfärdades.

64 §

Under de förutsättningar som anges i 65–67 §§ får ett publikt aktiebolag vars aktier är noterade vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad, lämna information till aktieägare med elektroniska hjälpmedel även när det i lagen anges att informationen skall lämnas på något annat sätt.

Under de förutsättningar som anges i 65–67 §§ får ett publikt aktiebolag vars aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet, lämna information till aktieägare med elektroniska hjälpmedel även när det i lagen anges att informationen skall lämnas på något annat sätt.

TP

2

PT

Senaste lydelse 2006:562.

215

Nuvarande lydelse Föreslagen lydelse

8 kap.

51 §

TPF

3

FPT

I ett aktiebolag, vars aktier är noterade vid en börs eller en auktoriserad marknadsplats, skall styrelsen varje år upprätta förslag till riktlinjer för bestämmande av lön och annan ersättning till den verkställande direktören och andra personer i bolagets ledning. Med ersättning jämställs överlåtelse av värdepapper och upplåtelse av rätt att i framtiden förvärva värdepapper från bolaget. Riktlinjerna skall avse tiden från nästa årsstämma.

I ett aktiebolag, vars aktier är upptagna till handel på en reglerad marknad i Sverige, skall styrelsen varje år upprätta förslag till riktlinjer för bestämmande av lön och annan ersättning till den verkställande direktören och andra personer i bolagets ledning. Med ersättning jämställs överlåtelse av värdepapper och upplåtelse av rätt att i framtiden förvärva värdepapper från bolaget. Riktlinjerna skall avse tiden från nästa årsstämma.

Information om tidigare beslutade ersättningar som inte har förfallit till betalning skall fogas till förslaget.

Om, i fall som avses i 53 §, de riktlinjer som bolagsstämman har beslutat om inte har följts, skall även information om detta och om skälet till avvikelsen fogas till förslaget.

Första stycket gäller inte sådana emissioner och överlåtelser som omfattas av 16 kap. Det gäller inte heller ersättning som omfattas av 23 a § första stycket.

9 kap.

13 §

TPF

4

FPT

Minst en av bolagsstämman utsedd revisor skall vara auktoriserad revisor eller godkänd revisor som har avlagt revisorsexamen, om

1. bolaget uppfyller mer än ett av följande villkor:

a) medelantalet anställda i bolaget har under vart och ett av de två senaste räkenskapsåren uppgått till mer än 50,

b) bolagets redovisade balansomslutning har för vart och ett av de två senaste räkenskapsåren uppgått till mer än 25 miljoner kronor,

c) bolagets redovisade nettoomsättning har för vart och ett av de två senaste räkenskapsåren uppgått till mer än 50 miljoner kronor, eller

2. bolagets aktier, teckningsoptioner eller skuldebrev är noterade vid en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad.

2. bolagets aktier, teckningsoptioner eller skuldebrev är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet.

TP

3

PT

Senaste lydelse 2006:562.

TP

4

PT

Senaste lydelse 2006:877.

216

Lydelse enligt prop. 2006/07:70 Föreslagen lydelse

13 kap.

4 §

I förslaget enligt 3 § skall följande anges:

1. det belopp eller högsta belopp, som bolagets aktiekapital skall ökas med, eller det lägsta och högsta beloppet för ökningen,

2. det antal aktier, högsta antal aktier eller lägsta och högsta antal aktier som skall ges ut,

3. det belopp som skall betalas för varje ny aktie (teckningskursen),

4. den rätt att teckna aktier som aktieägarna eller någon annan skall ha,

5. den tid inom vilken aktieteckning skall ske,

6. den fördelningsgrund som styrelsen skall tillämpa för aktier som inte tecknas med företrädesrätt,

7. den tid inom vilken aktierna skall betalas eller, i förekommande fall, att teckning skall ske genom betalning enligt 13 § tredje stycket, samt

8. från vilken tidpunkt de nya aktierna skall ge rätt till utdelning. Uppgifter som avses i första stycket 1 och 3 behöver inte anges i förslaget, om det föreslås att stämman skall besluta om ett sådant bemyndigande som avses i 5 § första stycket 8.

Teckningskursen enligt första stycket 3 får inte sättas lägre än de tidigare aktiernas kvotvärde. I bolag vars aktier är noterade vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad får dock teckningskursen vara lägre, om ett belopp som motsvarar skillnaden mellan teckningskursen och aktiernas kvotvärde tillförs aktiekapitalet genom överföring från bolagets eget kapital i övrigt eller genom uppskrivning av värdet av anläggningstillgångar. En sådan överföring eller uppskrivning skall ske innan beslutet om nyemission registreras.

Teckningskursen enligt första stycket 3 får inte sättas lägre än de tidigare aktiernas kvotvärde. I bolag vars aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet får dock teckningskursen vara lägre, om ett belopp som motsvarar skillnaden mellan teckningskursen och aktiernas kvotvärde tillförs aktiekapitalet genom överföring från bolagets eget kapital i övrigt eller genom uppskrivning av värdet av anläggningstillgångar. En sådan överföring eller uppskrivning skall ske innan beslutet om nyemission registreras.

Innebär förslaget enligt första stycket 4 en avvikelse från aktieägarnas företrädesrätt, skall skälen till avvikelsen samt grunderna för teckningskursen anges i förslaget eller i en bifogad handling.

Teckningstiden enligt första stycket 5 får inte understiga två veckor, om aktieägarna skall ha företrädesrätt till de nya aktierna. I bolag som inte är avstämningsbolag räknas denna tid från det att underrättelse enligt 12 § har skett eller, om samtliga aktieägare har varit företrädda på den stämma som har beslutat om emissionen, från beslutet. I avstämningsbolag räknas tiden från avstämningsdagen.

5 §

I förekommande fall skall förslaget enligt 3 § innehålla uppgift om

217

1. de nya aktiernas aktieslag, om det i bolaget finns eller kan ges ut aktier av olika slag,

2. huruvida förbehåll enligt 4 kap. 6, 8, 18 eller 27 § eller 20 kap. 31 § som gäller för gamla aktier i bolaget skall gälla för de nya aktierna,

3. att kuponger som hör till aktiebreven skall användas som emissionsbevis,

4. att överskjutande teckningsrätter skall säljas enligt 11 kap. 9 §,

5. avstämningsdagen, om bolaget är avstämningsbolag och aktieägare skall ha företrädesrätt att delta i emissionen,

6. att nya aktier skall betalas med apportegendom eller i annat fall på villkor som avses i 2 kap. 5 § andra stycket 1–3 och 5 eller att en aktie skall tecknas med kvittningsrätt,

7. övriga särskilda villkor för aktieteckning, och

8. bemyndigande för styrelsen eller den som styrelsen utser inom sig att innan teckningstiden börjar löpa besluta om vilket belopp som bolagets aktiekapital skall ökas med, det antal aktier som skall ges ut och vilket belopp som skall betalas för varje ny aktie.

Om emissionsbeslutet förutsätter ändring av bolagsordningen, skall också detta anges.

Avstämningsdagen får inte sättas tidigare än en vecka från dagen för beslutet.

I fråga om apportegendom gäller bestämmelserna i 2 kap. 6 §. Ett bemyndigande som avses i första stycket 8 får lämnas endast om aktierna skall noteras vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad. Om bolaget är avstämningsbolag och aktieägare skall ha företrädesrätt att delta i emissionen, skall bemyndigandet utformas så att villkoren beslutas senast den dag som infaller fem vardagar före avstämningsdagen.

Ett bemyndigande som avses i första stycket 8 får lämnas endast om aktierna skall tas upp till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet. Om bolaget är avstämningsbolag och aktieägare skall ha företrädesrätt att delta i emissionen, skall bemyndigandet utformas så att villkoren beslutas senast den dag som infaller fem vardagar före avstämningsdagen.

I fråga om publika aktiebolag gäller även 39 §.

14 kap.

5 §

I förekommande fall skall förslaget enligt 3 § innehålla uppgift om

1. att kuponger som hör till aktiebreven skall användas som emissionsbevis,

2. att överskjutande teckningsrätter skall säljas enligt 11 kap. 9 §,

3. avstämningsdagen, om bolaget är avstämningsbolag och aktieägare skall ha företrädesrätt att delta i emissionen,

4. det belopp som skall betalas för varje teckningsoption,

5. den tid inom vilken teckningsoptionerna skall betalas eller att teckning skall ske genom betalning enligt 15 § tredje stycket,

6. att teckningsoptionerna skall betalas med apportegendom eller i annat fall på villkor som avses i 2 kap. 5 § andra stycket 1–3 och 5 eller att teckningsoptioner skall tecknas med kvittningsrätt,

218

7. övriga särskilda villkor för tecknande av teckningsoptioner, och

8. bemyndigande för styrelsen eller den styrelsen utser inom sig att innan teckningstiden börjar löpa besluta om det antal teckningsoptioner som skall ges ut, vilket belopp som skall betalas för varje teckningsoption, teckningskursen samt sådana villkor som avses i 7.

Avstämningsdagen får inte sättas tidigare än en vecka från dagen för beslutet.

Ett bemyndigande som avses i första stycket 8 får lämnas endast om teckningsoptionerna skall noteras vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad. Om bolaget är avstämningsbolag och aktieägare skall ha företrädesrätt att delta i emissionen, skall bemyndigandet utformas så att villkoren beslutas senast den dag som infaller fem vardagar före avstämningsdagen.

Ett bemyndigande som avses i första stycket 8 får lämnas endast om teckningsoptionerna skall tas upp till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet. Om bolaget är avstämningsbolag och aktieägare skall ha företrädesrätt att delta i emissionen, skall bemyndigandet utformas så att villkoren beslutas senast den dag som infaller fem vardagar före avstämningsdagen.

15 kap.

5 §

I förekommande fall skall förslaget enligt 3 § innehålla uppgift om

1. att kuponger som hör till aktiebreven skall användas som emissionsbevis,

2. att överskjutande teckningsrätter skall säljas enligt 11 kap. 9 §, 3. avstämningsdagen, om bolaget är avstämningsbolag och att aktieägare skall ha företrädesrätt att delta i emissionen,

3. avstämningsdagen, om bolaget är avstämningsbolag och aktieägare skall ha företrädesrätt att delta i emissionen,

4. att konvertiblerna skall betalas med apportegendom eller i annat fall på villkor som avses i 2 kap. 5 § andra stycket 1–3 och 5 eller att en konvertibel skall tecknas med kvittningsrätt,

5. övriga särskilda villkor för det lån som bolaget tar genom emissionen, och

6. bemyndigande för styrelsen eller den som styrelsen utser inom sig att innan teckningstiden börjar löpa besluta om lånebelopp, det belopp som skall betalas för varje konvertibel, räntefot, konverteringskursen samt sådana villkor som avses i 5.

Avstämningsdagen får inte sättas tidigare än en vecka från tidpunkten för beslutet.

I fråga om apportegendom gäller bestämmelserna i 2 kap. 6 §. Ett bemyndigande som avses i första stycket 6 får lämnas endast om konvertiblerna skall noteras vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad. Om bolaget är avstämnings-

Ett bemyndigande som avses i första stycket 6 får lämnas endast om konvertiblerna skall tas upp till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet. Om bolaget är

219

bolag och aktieägare skall ha företrädesrätt att delta i emissionen, skall bemyndigandet utformas så att villkoren beslutas senast den dag som infaller fem vardagar före avstämningsdagen.

avstämningsbolag och aktieägare skall ha företrädesrätt att delta i emissionen, skall bemyndigandet utformas så att villkoren beslutas senast den dag som infaller fem vardagar före avstämningsdagen.

I fråga om publika aktiebolag gäller även 41 §.

Nuvarande lydelse Föreslagen lydelse

19 kap.

13 §

Ett publikt aktiebolag vars aktier är noterade vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad får, utöver vad som följer av 5 §, förvärva egna aktier enligt bestämmelserna i 14 och 15 §§. Beslut om förvärv skall i så fall fattas med tillämpning av 18–29 §§. Om bolaget har förvärvat aktier i strid med 14 eller

15 § eller i strid med 17 kap. 3 eller 4 §, gäller bestämmelserna i 16 §.

Ett publikt aktiebolag vars aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet får, utöver det som följer av 5 §, förvärva egna aktier enligt bestämmelserna i 14 och 15 §§. Beslut om förvärv skall i så fall fattas med tillämpning av 18– 29 §§. Om bolaget har förvärvat aktier i strid med 14 eller 15 § eller i strid med 17 kap. 3 eller 4 §, gäller bestämmelserna i 16 §.

14 §

Förvärv som avses i 13 § får ske endast

1. på en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad inom Europeiska ekonomiska samarbetsområdet,

1. på en reglerad marknad,

2. på en börs eller någon annan reglerad marknad utanför Europeiska ekonomiska samarbetsområdet efter tillstånd av Finansinspektionen, eller

2. på en marknad motsvarande en reglerad marknad utanför Europeiska ekonomiska samarbetsområdet efter tillstånd av Finansinspektionen, eller

3. i enlighet med ett förvärvserbjudande som har riktats till samtliga aktieägare eller samtliga ägare till aktier av ett visst slag.

Ett tillstånd enligt första stycket 2 skall ange på vilken börs eller marknad egna aktier får förvärvas samt under vilken tid tillståndet får utnyttjas. Tillstånd skall lämnas, om

Ett tillstånd enligt första stycket 2 skall ange på vilken marknad egna aktier får förvärvas samt under vilken tid tillståndet får utnyttjas. Tillstånd skall lämnas, om

1. det för verksamheten vid börsen eller marknaden finns regler som motsvarar vad som enligt lagen (1992:543) om börs-

1. det för verksamheten vid marknaden finns regler som motsvarar det som enligt lagen (2007:000) om värdepappers-

220

och clearingverksamhet gäller för verksamhet vid en börs eller en auktoriserad marknadsplats i Sverige, och

marknaden gäller för verksamhet vid en reglerad marknad i Sverige, och

2. börsen eller marknaden står under tillsyn av en myndighet eller något annat behörigt organ.

2. företaget som driver marknaden står under tillsyn av en myndighet eller något annat behörigt organ.

U

Överlåtelse av egna aktier på en börs, en auktoriserad marknadsplats eller en annan reglerad marknad

U

U

Överlåtelse av egna aktier på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet

U

32 §

Ett publikt aktiebolag får överlåta egna aktier

1. på en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad inom Europeiska ekonomiska samarbetsområdet, eller

1. på en reglerad marknad, eller

2. på en börs eller någon annan reglerad marknad utanför Europeiska ekonomiska samarbetsområdet efter tillstånd av Finansinspektionen.

2. på en marknad motsvarande en reglerad marknad utanför Europeiska ekonomiska samarbetsområdet efter tillstånd av Finansinspektionen.

Ett tillstånd enligt första stycket 2 skall ange på vilken börs eller marknad egna aktier får överlåtas samt under vilken tid tillståndet får utnyttjas. Tillstånd skall lämnas, om

Ett tillstånd enligt första stycket 2 skall ange på vilken marknad egna aktier får överlåtas samt under vilken tid tillståndet får utnyttjas. Tillstånd skall lämnas, om

1. det för verksamheten vid börsen eller marknaden finns regler som motsvarar vad som enligt lagen (1992:543) om börs- och clearingverksamhet gäller för verksamhet vid en börs eller en auktoriserad marknadsplats i Sverige, och

1. det för verksamheten vid marknaden finns regler som motsvarar det som enligt lagen (2007:000) om värdepappersmarknaden gäller för verksamhet vid en reglerad marknad i Sverige, och

2. börsen eller marknaden står under tillsyn av en myndighet eller något annat behörigt organ.

2. företaget som driver marknaden står under tillsyn av en myndighet eller något annat behörigt organ.

Lydelse enligt prop. 2006/07:70 Föreslagen lydelse

36 §

I sådana fall som anges i 35 § skall i förslaget till beslut följande anges:

221

1. det högsta antal aktier, i förekommande fall fördelat på aktieslag, som skall överlåtas,

2. den rätt att förvärva aktier som tillkommer aktieägarna eller någon annan,

2. den rätt att förvärva aktier som aktieägarna eller någon annan skall ha,

3. den tid inom vilken aktieägare eller annan kan utnyttja sin rätt att förvärva aktier,

4. den tid inom vilken aktierna skall betalas eller, i förekommande fall, att teckning skall ske genom betalning,

5. den fördelningsgrund som styrelsen skall tillämpa beträffande aktier som inte tecknas med företrädesrätt,

6. avstämningsdagen, om bolaget är avstämningsbolag och aktieägare skall ha företrädesrätt vid överlåtelsen,

7. det belopp som skall betalas för varje aktie,

8. villkor om apport eller att aktie skall tecknas med kvittningsrätt, och

9. övriga särskilda villkor för överlåtelsen. Tiden som anges i första stycket 3 får inte understiga två veckor. I bolag som inte är avstämningsbolag räknas denna tid från det att underrättelse enligt 13 kap. 12 § har skett, eller, om samtliga aktieägare har varit företrädda på den stämma som har beslutat om överlåtelsen, från beslutet. I avstämningsbolag räknas tiden från avstämningsdagen.

Avstämningsdagen får inte sättas tidigare än en vecka från dagen för beslutet.

I stället för en sådan föreskrift som anges i första stycket 7 får det anges att styrelsen eller den som styrelsen utser inom sig skall bemyndigas att innan den tid som avses i första stycket 3 börjar löpa besluta vilket belopp som skall betalas för varje aktie. Ett sådant bemyndigande får lämnas endast om aktierna skall noteras på en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad. Om bolaget är avstämningsbolag och aktieägare skall ha företrädesrätt att förvärva aktier, skall bemyndigandet utformas så att beloppet bestäms senast den dag som infaller fem vardagar före avstämningsdagen.

I stället för en sådan uppgift som anges i första stycket 7 får det anges att styrelsen eller den som styrelsen utser inom sig skall bemyndigas att innan den tid som avses i första stycket 3 börjar löpa besluta vilket belopp som skall betalas för varje aktie. Ett sådant bemyndigande får lämnas endast om aktierna skall tas upp till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet. Om bolaget är avstämningsbolag och aktieägare skall ha företrädesrätt att förvärva aktier, skall bemyndigandet utformas så att beloppet bestäms senast den dag som infaller fem vardagar före avstämningsdagen.

20 kap.

10 §

I förekommande fall skall, i fråga om sådan inlösen som avses i 9 §, förslaget om minskning av aktiekapitalet också innehålla uppgift om

1. att anmälan för inlösen skall ske genom att kuponger som hör till aktiebreven ges in,

222

2. att inlösta aktier skall betalas med annan egendom än pengar eller i övrigt på villkor som avses i 2 kap. 5 § andra stycket 1–3 och 5 eller att inlösen skall ske genom kvittning av en fordran som bolaget har mot aktieägaren,

3. avstämningsdagen eller bemyndigande för styrelsen att fastställa avstämningsdagen, om bolaget är avstämningsbolag,

4. övriga särskilda villkor för inlösen, och

5. bemyndigande för styrelsen eller den som styrelsen utser inom sig att innan inlösen påbörjas bestämma det belopp som aktiekapitalet skall minskas med och det belopp som skall betalas för varje aktie som löses in.

Ett bemyndigande som avses i första stycket 3 eller 5 får lämnas bara om aktierna är noterade vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad. I avstämningsbolag skall ett bemyndigande enligt första stycket 5 utformas så att minskningsbeloppet och det belopp som skall betalas för varje aktie som löses in bestäms senast den dag som infaller fem vardagar före avstämningsdagen.

Ett bemyndigande som avses i första stycket 3 eller 5 får lämnas bara om aktierna är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet. I avstämningsbolag skall ett bemyndigande enligt första stycket 5 utformas så att minskningsbeloppet och det belopp som skall betalas för varje aktie som löses in bestäms senast den dag som infaller fem vardagar före avstämningsdagen.

Avstämningsdagen enligt första stycket 3 får inte infalla senare än dagen före nästa årsstämma.

Nuvarande lydelse Föreslagen lydelse

22 kap.

2 §

Om frågan om lösenbeloppet för en aktie som skall lösas in enligt detta kapitel är tvistig, skall lösenbeloppet bestämmas med tillämpning av andra–fjärde styckena.

Lösenbeloppet för en aktie skall bestämmas så att det motsvarar det pris för aktien som kan påräknas vid en försäljning under normala förhållanden. För en aktie som är föremål för handel vid en svensk eller utländsk börs, en auktoriserad marknadsplats eller någon annan reglerad marknad skall lösenbeloppet motsvara det noterade värdet, om inte särskilda skäl motiverar något annat.

Lösenbeloppet för en aktie skall bestämmas så att det motsvarar det pris för aktien som kan påräknas vid en försäljning under normala förhållanden. För en aktie som är föremål för handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet skall lösenbeloppet motsvara det noterade värdet, om inte särskilda skäl motiverar något annat.

Lösenbeloppet skall bestämmas med hänsyn till förhållandena vid den tidpunkt då begäran om prövning av skiljemän enligt 5 § gjordes. Om det finns skäl för det, får beloppet i stället bestämmas med hänsyn till förhållandena vid en tidpunkt som infaller tidigare.

223

Har ett yrkande om inlösen av aktie enligt detta kapitel föregåtts av ett offentligt erbjudande att förvärva samtliga aktier som budgivaren inte redan innehar och har detta erbjudande antagits av ägare till mer än nio tiondelar av de aktier som erbjudandet avser, skall lösenbeloppet motsvara det erbjudna vederlaget, om inte särskilda skäl motiverar något annat.

U

Denna lag träder i kraft den 1 november 2007.

224

2.40 Förslag till lag om ändring i lagen (2005:1047) om internationella förhållanden rörande försäkringsföretags och kreditinstituts insolvens

Härigenom föreskrivs att 12 § lagen (2005:1047) om internationella förhållanden rörande försäkringsföretags och kreditinstituts insolvens skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

12 §

I fråga om verkan av förfarandet på sådan rätt som följer av ett avtal på en börs eller en annan reglerad marknad för finansiella instrument eller på ett avtal om avräkning eller återköp tillämpas den lag som gäller för avtalet.

I fråga om verkan av förfarandet på sådan rätt som följer av ett avtal på en reglerad marknad för finansiella instrument eller på ett avtal om avräkning eller återköp tillämpas den lag som gäller för avtalet.

U

Denna lag träder i kraft den 1 november 2007.

225

2.41 Förslag till lag om ändring i lagen (2006:451) om offentliga uppköpserbjudanden på aktiemarknaden

Härigenom föreskrivs att 1 kap. 2 §, 2 kap.1 och 2 §§, 3 kap. 1 § och 7 kap. 12 § lagen (2006:451) om offentliga uppköpserbjudanden på aktiemarknaden skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

1 kap.

2 §

I denna lag förstås med

1. offentligt uppköpserbjudande: ett offentligt erbjudande till innehavare av aktier som har getts ut av ett svenskt eller utländskt aktiebolag att överlåta samtliga eller en del av dessa aktier,

2.

U

börs och auktoriserad mark-

nadsplats

U

: sådana företag som

avses i 1 kap. 4 § 1 och 3 lagen (1992:543) om börs- och clearingverksamhet,

2.

U

börs

U

: det som anges i 1 kap.

5 § 3 lagen (2007:000) om värdepappersmarknaden och sådant utländskt företag som har tillstånd att driva en reglerad marknad från filial i Sverige,

3. budgivare: den som lämnar ett offentligt uppköpserbjudande, 4.

U

koncern

U

: sådana företags-

grupper som avses i 1 kap.11 och 12 §§aktiebolagslagen (2005:551) och 1 kap. 9 § försäkringsrörelselagen (1982:713), varvid det som sägs om moderbolag skall tillämpas även på andra svenska eller utländska rättssubjekt än aktiebolag.

4.

U

koncern

U

: sådana företags-

grupper som avses i 1 kap.11 och 12 §§aktiebolagslagen (2005:551) och 1 kap. 9 § försäkringsrörelselagen (1982:713), varvid det som sägs om moderbolag skall tillämpas även på andra svenska eller utländska rättssubjekt än aktiebolag, och

5.

U

reglerad marknad

U

: det som

anges i 1 kap. 5 § 20 lagen om värdepappersmarknaden.

2 kap.

1 §

Ett offentligt uppköpserbjudande i fråga om sådana aktier som avses i andra stycket får lämnas endast av den som gentemot den börs eller auktoriserade marknadsplats där bolagets aktier är noterade har åtagit sig att

Ett offentligt uppköpserbjudande i fråga om sådana aktier som avses i andra stycket får lämnas bara av den som gentemot den börs som driver den reglerade marknad där bolagets aktier är upptagna till handel har åtagit sig att

1. följa de regler som börsen eller den auktoriserade marknadsplatsen har fastställt för sådana erbjudanden, och

1. följa de regler som börsen har fastställt för sådana erbjudanden, och

226

2. underkasta sig de sanktioner som börsen eller den auktoriserade marknadsplatsen får besluta om vid överträdelse av dessa regler.

2. underkasta sig de sanktioner som börsen får besluta om vid överträdelse av dessa regler.

Första stycket skall tillämpas på offentliga uppköpserbjudanden som avser

1. aktier i ett svenskt aktiebolag, vars aktier är noterade vid en börs eller auktoriserad marknadsplats i Sverige,

1. aktier i ett svenskt aktiebolag, vars aktier är upptagna till handel på en reglerad marknad i Sverige,

2. aktier i ett utländskt aktiebolag, vars aktier är noterade endast vid en börs eller auktoriserad marknadsplats i Sverige,

2. aktier i ett utländskt aktiebolag, vars aktier är upptagna till handel bara på en reglerad marknad i Sverige,

3. aktier i ett utländskt aktiebolag, vars aktier inte är noterade i den stat där bolaget har sitt hemvist men som är noterade vid en börs eller auktoriserad marknadsplats i Sverige och är upptagna till handel också på en annan reglerad marknad inom Europeiska ekonomiska samarbetsområdet, om aktierna först upptogs till handel på den svenska börsen eller auktoriserade marknadsplatsen, eller

3. aktier i ett utländskt aktiebolag, vars aktier inte är noterade i den stat där bolaget har sin hemvist men som är upptagna till handel på en reglerad marknad i Sverige och är upptagna till handel också på en annan reglerad marknad inom Europeiska ekonomiska samarbetsområdet, om aktierna först upptogs till handel på den reglerade marknaden i Sverige, eller

4. aktier i ett utländskt aktiebolag, vars aktier inte är noterade i den stat där bolaget har sitt hemvist men som är noterade vid en börs eller auktoriserad marknadsplats i Sverige och som första gången de upptogs till handel då upptogs till handel samtidigt också på en eller flera andra reglerade marknader inom Europeiska ekonomiska samarbetsområdet, om bolaget har anmält att Finansinspektionen skall vara tillsynsmyndighet.

4. aktier i ett utländskt aktiebolag, vars aktier inte är noterade i den stat där bolaget har sin hemvist men som är upptagna till handel på en reglerad marknad i Sverige och som första gången de upptogs till handel då upptogs till handel samtidigt också på en eller flera andra reglerade marknader inom Europeiska ekonomiska samarbetsområdet, om bolaget har anmält att Finansinspektionen skall vara tillsynsmyndighet.

Finansinspektionen skall offentliggöra en sådan anmälan som avses i andra stycket 4.

2 §

Budgivaren skall i samband med att ett erbjudande enligt 1 § lämnas informera Finansinspektionen om erbjudandet och åtagandet gentemot börsen eller den auktoriserade marknadsplatsen.

Budgivaren skall i samband med att ett erbjudande enligt 1 § lämnas informera Finansinspektionen om erbjudandet och åtagandet gentemot börsen.

227

Om budgivaren offentliggör information om ett planerat erbjudande, skall den informationen samtidigt lämnas till Finansinspektionen.

3 kap.

1 §

Den som inte innehar några aktier eller innehar aktier som representerar mindre än tre tiondelar av röstetalet för samtliga aktier i ett sådant bolag som avses i andra stycket och genom förvärv av aktier i bolaget, ensam eller tillsammans med någon som är närstående enligt 5 §, uppnår ett aktieinnehav som representerar minst tre tiondelar av röstetalet för samtliga aktier i bolaget skall

1. omedelbart offentliggöra hur stort hans eller hennes aktieinnehav i bolaget är, och

2. inom fyra veckor därefter lämna ett offentligt uppköpserbjudande avseende resterande aktier i bolaget (budplikt).

Första stycket gäller vid förvärv av aktier i ett svenskt aktiebolag vars aktier är noterade vid en börs, en auktoriserad marknadsplats eller någon annan reglerad marknad.

Första stycket gäller vid förvärv av aktier i ett svenskt aktiebolag vars aktier är upptagna till handel på en reglerad marknad eller en motsvarande marknad utanför Europeiska ekonomiska samarbetsområdet.

I 4 § finns bestämmelser om att Finansinspektionen kan besluta att budplikten skall fullgöras av annan än vad som följer av denna paragraf.

7 kap.

12 §

Om aktierna i ett svenskt aktiebolag, vars aktier inte tidigare är noterade vid en börs eller auktoriserad marknadsplats i Sverige och inte heller är upptagna till handel i någon annan stat, tas upp till handel samtidigt vid två eller flera reglerade marknader i andra stater inom Europeiska ekonomiska samarbetsområdet än Sverige gäller följande. Bolaget skall på den första handelsdagen bestämma vilken tillsynsmyndighet i de staterna som skall vara behörig att utöva tillsyn över offentliga uppköpserbjudanden avseende aktierna i bolaget genom att anmäla detta till de reglerade marknaderna och tillsynsmyndigheterna.

Om aktierna i ett svenskt aktiebolag, vars aktier inte tidigare är upptagna till handel på en reglerad marknad i Sverige och inte heller är upptagna till handel i någon annan stat, tas upp till handel samtidigt vid två eller flera reglerade marknader i andra stater inom Europeiska ekonomiska samarbetsområdet än Sverige gäller följande. Bolaget skall på den första handelsdagen bestämma vilken tillsynsmyndighet i de staterna som skall vara behörig att utöva tillsyn över offentliga uppköpserbjudanden avseende aktierna i bolaget genom att anmäla detta till de reglerade marknaderna och tillsynsmyndigheterna.

U

Denna lag träder i kraft den 1 november 2007.

228

2.42 Förslag till lag om ändring i lagen (2006:531) om särskild tillsyn över finansiella konglomerat

Härigenom föreskrivs att 1 kap. 3 § lagen (2006:531) om särskild tillsyn över finansiella konglomerat skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

1 kap.

3 §

I denna lag betyder

1. anknutet företag: ett svenskt eller utländskt företag vars huvudsakliga verksamhet är att äga eller förvalta fast egendom, tillhandahålla datatjänster eller driva annan liknande verksamhet som har samband med den huvudsakliga verksamheten i ett eller flera kreditinstitut, värdepappersbolag eller motsvarande utländska företag,

2. behörig myndighet: Finansinspektionen eller någon annan myndighet inom EES som utövar tillsyn, individuellt eller på gruppnivå, över ett reglerat företag med huvudkontor inom EES,

3. blandat finansiellt holdingföretag: ett moderföretag som inte är ett reglerat företag och som tillsammans med sina dotterföretag, varav minst ett är ett reglerat företag med huvudkontor inom EES, och andra företag utgör ett finansiellt konglomerat,

4. EES: Europeiska ekonomiska samarbetsområdet,

5. finansiellt institut: ett företag som inte är ett kreditinstitut, värdepappersbolag eller fondbolag eller motsvarande utländskt företag och vars huvudsakliga verksamhet är att

a) förvärva aktier eller andelar,

b) driva värdepappersrörelse utan att vara tillståndspliktigt enligt 1 kap. 3 § lagen (1991:981) om värdepappersrörelse, eller

c) driva en eller flera av de verksamheter som anges i 7 kap. 1 § andra stycket 2–10 och 12 lagen (2004:297) om bank- och finansieringsrörelse utan att vara tillståndspliktigt enligt 2 kap. 1 § samma lag,

b) driva en eller flera av de verksamheter som anges i 7 kap. 1 § andra stycket 2–10 och 12 lagen (2004:297) om bank- och finansieringsrörelse utan att vara tillståndspliktigt enligt 2 kap. 1 § samma lag, eller

c) driva värdepappersrörelse utan att vara tillståndspliktigt enligt 2 kap. 1 § lagen (2007:000) om värdepappersmarknaden,

6. finansiell sektor: ett eller flera av följande företag

a) kreditinstitut, värdepappersbolag, fondbolag eller motsvarande utländska företag samt finansiella institut och anknutna företag (bank- och värdepapperssektorn),

b) försäkringsföretag, utländska direktförsäkringsföretag, utländska återförsäkringsföretag och försäkringsholdingföretag (försäkringssektorn), och

229

c) blandade finansiella holdingföretag,

7. fondbolag: ett svenskt aktiebolag som har fått tillstånd att driva fondverksamhet enligt lagen (2004:46) om investeringsfonder,

8. försäkringsföretag: en understödsförening enligt lagen (1972:262) om understödsföreningar eller ett försäkringsbolag enligt försäkringsrörelselagen (1982:713),

9. försäkringsholdingföretag: ett moderföretag som inte är ett försäkringsföretag, ett utländskt direktförsäkringsföretag, ett utländskt återförsäkringsföretag eller ett blandat finansiellt holdingföretag och vars huvudsakliga verksamhet är att förvärva och förvalta andelar i dotterföretag som uteslutande eller huvudsakligen är försäkringsbolag, utländska direktförsäkringsföretag eller utländska återförsäkringsföretag,

10. institut: kreditinstitut, värdepappersbolag och fondbolag, 11. konglomeratdirektivet: Europaparlamentets och rådets direktiv 2002/87/EG av den 16 december 2002 om extra tillsyn över kreditinstitut, försäkringsföretag och värdepappersföretag i ett finansiellt konglomerat och om ändring av rådets direktiv 73/239/EEG, 79/267/EEG, 92/49/EEG, 92/96/EEG, 93/6/EEG och 93/22/EEG samt Europaparlamentets och rådets direktiv 98/78/EG och 2000/12/EG

TPF

1

FPT

,

ändrat genom Europaparlamentets och rådets direktiv 2005/1/EG

TPF

2

FPT

,

12. kreditinstitut:

a) en bank eller ett kreditmarknadsföretag enligt lagen om bank- och finansieringsrörelse, eller

b) ett institut för elektroniska pengar enligt lagen (2002:149) om utgivning av elektroniska pengar,

13. reglerat företag:

a) ett institut eller ett motsvarande utländskt företag, eller

b) ett försäkringsföretag eller ett utländskt direktförsäkringsföretag, 14. relevant behörig myndighet:

a) en behörig myndighet som ansvarar för tillsynen över en finansiell företagsgrupp, försäkringsgrupp eller en motsvarande utländsk grupp som ingår i ett finansiellt konglomerat,

b) någon annan behörig myndighet än som avses i a som utsetts till samordnare för ett finansiellt konglomerat, eller

c) någon annan behörig myndighet som de myndigheter som avses i a och b kommer överens om är relevant,

15. samordnare: den behöriga myndighet som enligt 4 kap. ansvarar för tillsynen över ett finansiellt konglomerat,

16. sektorsbestämmelser: de bestämmelser i lag och andra författningar som gäller för den rörelse som drivs av institut och försäkringsföretag,

17. utländskt återförsäkringsföretag: ett företag som inte är ett försäkringsföretag eller ett utländskt direktförsäkringsföretag och vars huvudsakliga verksamhet är att försäkra risker som överlåts av försäkringsföretag, utländska direktförsäkringsföretag eller utländska återförsäkringsföretag, och

18.

U

värdepappersbolag

U

: ett

svenskt aktiebolag som har fått tillstånd att driva värdepappers-

18.

U

värdepappersbolag

U

: ett

svenskt aktiebolag som har fått tillstånd att driva värdepappers-

TP

1

PT

EUT L 35, 11.2.2003, s. 1 (Celex 32002L0087).

TP

2

PT

EUT L 79, 24.3.2005, s. 9 (Celex 32005L0001).

230

rörelse enligt lagen om värdepappersrörelse.

rörelse enligt lagen om värdepappersmarknaden.

U

Denna lag träder i kraft den 1 november 2007.

231

2.43 Förslag till lag om ändring i lagen (2006:1371) om kapitaltäckning och stora exponeringar

Härigenom föreskrivs att 1 kap.3 och 10 §§, 2 kap.2, 8 och 9 §§, 4 kap. 8 §, 5 kap. 3 §, 6 kap.4 och 7 §§ samt 9 kap. 5 § lagen (2006:1371) om kapitaltäckning och stora exponeringar skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

1 kap.

3 §

I denna lag betyder

1. anknutet företag: ett svenskt eller utländskt företag vars huvudsakliga verksamhet består i att äga eller förvalta fast egendom, tillhandahålla datatjänster eller driva annan liknande verksamhet som har samband med den huvudsakliga verksamheten i ett eller flera kreditinstitut, värdepappersbolag, institut för elektroniska pengar eller motsvarande utländska företag,

2. behörig myndighet: Finansinspektionen eller en annan myndighet inom EES som utövar tillsyn över institut, institut för elektroniska pengar eller motsvarande utländska företag,

3. EES: Europeiska ekonomiska samarbetsområdet,

4. exponeringar: poster som redovisas som tillgång i balansräkningen, derivatavtal som redovisas som skulder eller åtaganden utanför balansräkningen,

5. finansiellt holdingföretag: ett finansiellt institut som inte är ett blandat finansiellt holdingföretag enligt 1 kap. 3 § 3 lagen (2006:531) om särskild tillsyn över finansiella konglomerat och

a) som har minst ett dotterföretag som är kreditinstitut, värdepappersbolag, institut för elektroniska pengar eller motsvarande utländskt företag, och

b) vars dotterföretag uteslutande eller huvudsakligen utgörs av sådana företag som avses i a eller finansiella institut,

6. finansiellt institut: ett svenskt eller utländskt företag som inte är kreditinstitut, värdepappersbolag, institut för elektroniska pengar eller motsvarande utländskt företag och vars huvudsakliga verksamhet är att

a) förvärva eller inneha aktier eller andelar,

b) driva värdepappersrörelse utan att vara tillståndspliktigt enligt 1 kap. 3 § lagen (1991:981) om värdepappersrörelse, eller

c) driva en eller flera av de verksamheter som anges i 7 kap. 1 § andra stycket 2–10 och 12 lagen (2004:297) om bank- och finansieringsrörelse, utan att vara tillståndspliktigt enligt 2 kap. 1 § samma lag,

b) driva en eller flera av de verksamheter som anges i 7 kap. 1 § andra stycket 2–10 och 12 lagen (2004:297) om bank- och finansieringsrörelse, utan att vara tillståndspliktigt enligt 2 kap. 1 § samma lag, eller

232

c) driva värdepappersrörelse utan att vara tillståndspliktigt enligt 2 kap. 1 § lagen (2007:000) om värdepappersmarknaden,

7. finansiellt instrument: ett avtal som ger upphov till en finansiell tillgång för en part samtidigt som en annan part får en finansiell skuld eller utfärdar ett egetkapitalinstrument,

8. finansiellt moderholdingföretag inom EES: ett inom EES etablerat finansiellt holdingföretag, som inte är dotterföretag till ett institut eller ett motsvarande utländskt företag som auktoriserats inom EES eller till ett annat finansiellt holdingföretag som är etablerat inom EES,

9. holdingföretag med blandad verksamhet: ett svenskt eller utländskt moderföretag som inte är kreditinstitut, värdepappersbolag, institut för elektroniska pengar, motsvarande utländskt företag, finansiellt holdingföretag eller ett blandat finansiellt holdingföretag enligt 1 kap. 3 § 3 lagen om särskild tillsyn över finansiella konglomerat, men som har minst ett dotterföretag som är kreditinstitut, värdepappersbolag, institut för elektroniska pengar eller motsvarande utländskt företag,

10. institut: kreditinstitut och värdepappersbolag, 11. kapitalkravsdirektivet: Europaparlamentets och rådets direktiv 2006/49/EG av den 14 juni 2006 om kapitalkrav för värdepappersföretag och kreditinstitut (omarbetning)

TPF

1

FPT

,

12. kreditinstitut: bank, kreditmarknadsföretag och Svenska skeppshypotekskassan,

13. kreditinstitutsdirektivet: Europaparlamentets och rådets direktiv 2006/48/EG av den 14 juni 2006 om rätten att starta och driva verksamhet i kreditinstitut (omarbetning)

TPF

2

FPT

,

14. moderinstitut inom EES: ett institut eller motsvarande utländskt företag som auktoriserats inom EES och som

a) har ett institut, ett finansiellt institut eller ett motsvarande utländskt företag som dotterföretag eller som har ett ägarintresse i ett sådant företag, och

b) inte är dotterföretag till ett annat institut eller ett motsvarande utländskt företag som auktoriserats inom EES eller till ett finansiellt holdingföretag som är etablerat inom EES,

15. operativa risker: risker för förluster till följd av inte ändamålsenliga eller inte fungerande interna förfaranden eller system eller på grund av mänskliga fel eller yttre händelser, samt rättsliga risker,

16. riskvikt: en procentsats som beskriver en risknivå hos en exponering,

17. värdepapperisering: en transaktion eller ett program varigenom den kreditrisk som är förenad med en exponering eller en grupp exponeringar delas upp i delar, och som har följande egenskaper:

a) betalningarna inom ramen för transaktionen eller programmet är beroende av utvecklingen av exponeringen eller gruppen av exponeringar, och

b) prioriteringen av delarna avgör hur förluster fördelas under den tid transaktionen eller programmet pågår,

TP

1

PT

EUT L 177, 30.6.2006, s. 201 (Celex 32006L0049).

TP

2

PT

EUT L 177, 30.6.2006, s. 1 (Celex 32006L0048).

233

18.

U

värdepappersbolag

U

: ett

svenskt aktiebolag som har fått tillstånd att driva värdepappersrörelse enligt lagen (1991:981) om värdepappersrörelse.

18.

U

värdepappersbolag

U

: ett

svenskt aktiebolag som har fått tillstånd att driva värdepappersrörelse enligt lagen om värdepappersmarknaden.

10 §

Ett institut skall fastställa vilka positioner som skall ingå i handelslagret enligt 7 och 9 §§. För de positioner som innehas i handelssyfte skall instituten ha en handelsstrategi samt kunna styra handeln med positionerna och övervaka positionerna mot handelsstrategin. Institutet skall för dessa ändamål ha lämpliga metoder samt de skriftliga riktlinjer och instruktioner som behövs.

Av 1 kap. 6 d § lagen (1991:981) om värdepappersrörelse och 6 kap. 2 § lagen (2004:297) om bank- och finansieringsrörelse framgår att instituten skall kunna hantera de risker som följer med verksamheten i handelslagret.

Av 6 kap. 2 § lagen (2004:297) om bank- och finansieringsrörelse och 8 kap. 4 § lagen (2007:000) om värdepappersmarknaden framgår att instituten skall kunna hantera de risker som följer med verksamheten i handelslagret.

2 kap.

2 §

Finansinspektionen skall besluta att ett institut skall ha en viss minsta storlek på sin kapitalbas som är större än vad som krävs enligt 1 § första stycket 1, om

1. institutet inte uppfyller något av kraven i 1 kap.6 c6 h §§ lagen (1991:981) om värdepappersrörelse eller 6 kap.13, 4 a, 4 b och 5 §§ lagen (2004:297) om bank- och finansieringsrörelse, och

1. institutet inte uppfyller något av kraven i 6 kap.13, 4 a, 4 b och 5 §§ lagen (2004:297) om bank- och finansieringsrörelse eller 8 kap.38 §§ lagen (2007:000) om värdepappersmarknaden, och

2. det inte är troligt att någon annan åtgärd är tillräcklig för att få institutet att rätta till bristerna inom rimlig tid.

Första stycket skall inte tillämpas, om överträdelsen är så allvarlig att verksamhetstillståndet i stället skall återkallas.

8 §

Ett värdepappersbolag får, efter tillstånd av Finansinspektionen, beräkna kapitalkravet för operativa risker enligt andra stycket om det tillhör någon av följande kategorier:

1. Värdepappersbolag som handlar med finansiella instrument för egen räkning bara i syfte att

a) utföra en order för kunds räkning, eller b) få tillträde till system för clearing och avveckling eller en erkänd börs när de uppträder som agent eller utför kundorder.

b) få tillträde till system för clearing och avveckling eller en erkänd börs när de uppträder som ombud eller utför kundorder.

2. Värdepappersbolag a) som inte innehar klienters a) som inte innehar kunders

234

pengar eller värdepapper, pengar eller värdepapper,

b) som enbart handlar med finansiella instrument för egen räkning,

c) som inte har några externa kunder, och d) för vilkas transaktioner ansvaret för genomförandet och avräkningen ligger hos ett clearinginstitut och garanteras av samma clearinginstitut.

d) för vilkas transaktioner ansvaret för genomförandet och avvecklingen ligger hos en clearingorganisation och garanteras av samma clearingorganisation.

Kapitalkravet för operativa risker skall motsvara minst 25 procent av värdepappersbolagets fasta omkostnader beräknade enligt 10 §.

9 §

Ett värdepappersbolag som inte ägnar sig åt handel med finansiella instrument för egen räkning, garantigivning eller annan medverkan vid emissioner av fondpapper eller erbjudanden om köp eller försäljning av finansiella instrument som är riktade till en öppen krets, får i stället för det som anges i 1 § första stycket 1 ha en kapitalbas som motsvarar det största av

Ett värdepappersbolag som inte har tillstånd enligt 2 kap. 1 § 3 eller 6 lagen (2007:000) om värdepappersmarknaden, får i stället för det som anges i 1 § första stycket 1 ha en kapitalbas som motsvarar det största av

1. summan av kapitalkraven för kreditrisker och marknadsrisker beräknade enligt 3–6 §§ och det särskilda kapitalkravet enligt 7 kap. 8 §, och

2. 25 procent av bolagets fasta omkostnader beräknade enligt 10 §.

4 kap.

8 §

Tillstånd för ett institut att använda en internmetod skall ges om förutsättningarna i 9 § är uppfyllda och om

1. institutet har ett för ändamålet lämpligt utformat riskhanteringssystem för kreditrisker som uppfyller kraven i 1 kap.6 d och 6 h §§ lagen (1991:981) om värdepappersrörelse och 6 kap.2 och 5 §§ lagen (2004:297) om bank- och finansieringsrörelse,

1. institutet har ett för ändamålet lämpligt utformat riskhanteringssystem för kreditrisker som uppfyller kraven i 6 kap.2 och 5 §§ lagen (2004:297) om bank- och finansieringsrörelse samt 8 kap.4 och 8 §§ lagen (2007:000) om värdepappersmarknaden,

2. institutets riskklassificeringssystem är tillförlitligt och tillräckligt integrerat med institutets övriga verksamhet, och

3. institutet dokumenterar sitt riskklassificeringssystem och motiven för dess utformning.

Om ett moderinstitut inom EES och dess dotterföretag eller ett finansiellt moderholdingföretag inom EES och dess dotterföretag använder internmetoden enhetligt, får företagen i den omfattning som framgår av föreskrifter meddelade med stöd av 13 kap. 1 § 13 betraktas

235

som en enhet vid bedömningen av om kraven i första stycket är uppfyllda.

5 kap.

3 §

Ett institut får, efter tillstånd av Finansinspektionen, använda egna riskberäkningsmodeller för att beräkna kapitalkraven för positionsrisker, valutakursrisker och råvarurisker. Tillstånd skall ges om institutet

1. har ett för ändamålet lämpligt utformat riskhanteringssystem för marknadsrisker som uppfyller kraven i 1 kap.6 d och 6 h §§ lagen (1991:981) om värdepappersrörelse och 6 kap.2 och 5 §§ lagen (2004:297) om bank- och finansieringsrörelse,

1. har ett för ändamålet lämpligt utformat riskhanteringssystem för marknadsrisker som uppfyller kraven i 6 kap.2 och 5 §§ lagen (2004:297) om bank- och finansieringsrörelse samt 8 kap.4 och 8 §§ lagen (2007:000) om värdepappersmarknaden,

2. använder en riskberäkningsmodell som ger en tillförlitlig bild av marknadsriskernas storlek och som är tillräckligt integrerad med institutets övriga verksamhet, och

3. dokumenterar sin riskberäkningsmodell och motiven för dess utformning.

6 kap.

4 §

Ett institut som använder schablonmetoden för operativa risker skall

1. med stöd av skriftliga riktlinjer och instruktioner som ses över regelbundet fördela rörelseintäkterna, eller det beräkningsunderlag som motsvarar rörelseintäkterna, mellan olika affärsområden på ett lämpligt sätt, och

2. ha ett för ändamålet lämpligt utformat riskhanteringssystem för operativa risker som uppfyller kraven i 1 kap.6 d och 6 h §§ lagen (1991:981) om värdepappersrörelse och 6 kap.2 och 5 §§ lagen (2004:297) om bank- och finansieringsrörelse.

2. ha ett för ändamålet lämpligt utformat riskhanteringssystem för operativa risker som uppfyller kraven i 6 kap.2 och 5 §§ lagen (2004:297) om bank- och finansieringsrörelse samt 8 kap.4 och 8 §§ lagen (2007:000) om värdepappersmarknaden.

7 §

Tillstånd att använda internmätningsmetoden skall ges, om

1. institutet har ett för ändamålet lämpligt utformat riskhanteringssystem för operativa risker som uppfyller kraven i 1 kap.6 d och 6 h §§ lagen (1991:981) om värdepappersrörelse och 6 kap.2 och 5 §§ lagen (2004:297) om bank- och finansieringsrörelse, och

1. institutet har ett för ändamålet lämpligt utformat riskhanteringssystem för operativa risker som uppfyller kraven i 6 kap.2 och 5 §§ lagen (2004:297) om bank- och finansieringsrörelse samt 8 kap.4 och 8 §§ lagen (2007:000) om värdepappersmarknaden, och

2. institutets riskmätningssystem är tillförlitligt och tillräckligt integrerat med institutets övriga verksamhet.

236

Om ett moderinstitut inom EES och dess dotterföretag eller ett finansiellt moderholdingföretag inom EES och dess dotterföretag använder en internmätningsmetod enhetligt, får företagen i den omfattning som framgår av föreskrifter meddelade med stöd av 13 kap. 1 § 26 betraktas som en enhet vid bedömningen av om kraven i första stycket är uppfyllda.

9 kap.

5 §

Det ansvariga institutet enligt 3 § skall se till att den finansiella företagsgruppen sammantaget uppfyller kraven i

1. 2 kap. 1–7 §§ om kapitalkrav,

2. 7 kap. om stora exponeringar,

3. 7 kap.911 §§ lagen (2004:297) om bank- och finansieringsrörelse om ett kreditinstituts innehav av aktier och andelar i företag, om ett kreditinstitut ingår i gruppen,

4. 3 kap. 1 a § lagen (1991:981) om värdepappersrörelse om ett värdepappersbolags kvalificerade innehav av aktier eller andelar i företag med annan verksamhet än finansiell verksamhet, om ett värdepappersbolag som har tillstånd att bedriva verksamhet som avses i 3 kap. 4 § första stycket 4 och 5 samma lag ingår i gruppen, och

4. 7 kap. 7 § lagen (2007:000) om värdepappersmarknaden om ett värdepappersbolags kvalificerade innehav av aktier eller andelar i företag med annan verksamhet än finansiell verksamhet, om ett värdepappersbolag som har tillstånd att bedriva verksamhet som avses i 2 kap. 2 § första stycket 2 och 8 samma lag ingår i gruppen, och

5. 1 kap. 6 c § och 6 d § andra stycket lagen om värdepappersrörelse eller 6 kap. 1 § och 2 § andra stycket lagen om bank- och finansieringsrörelse om soliditet och riskhantering.

5. 6 kap. 1 § och 2 § andra stycket lagen om bank- och finansieringsrörelse eller 8 kap. 3 § och 4 § andra stycket lagen om värdepappersmarknaden om soliditet och riskhantering.

En finansiell företagsgrupp skall uppfylla kraven i 1 kap. 6 d § första stycket och 6 e § lagen om värdepappersrörelse samt 6 kap. 2 § första stycket och 3 § lagen om bank- och finansieringsrörelse om riskhantering och genomlysning.

En finansiell företagsgrupp skall uppfylla kraven i 6 kap. 2 § första stycket och 3 § lagen om bank- och finansieringsrörelse samt 8 kap. 4 § första stycket och 5 § lagen om värdepappersmarknaden om riskhantering och genomlysning.

U

Denna lag träder i kraft den 1 november 2007.

237

2.44 Förslag till lag om ändring i lagen (2006:1372) om införande av lagen (2006:1371) om kapitaltäckning och stora exponeringar

Härigenom föreskrivs att 8 och 9 §§ lagen (2006:1372) om införande av lagen (2006:1371) om kapitaltäckning och stora exponeringar skall ha följande lydelse.

Nuvarande lydelse Föreslagen lydelse

8 §

Ett värdepappersbolag som tillhandahåller investeringstjänster avseende sådana finansiella instrument som anges i punkterna 5–7, 9 och 10 i avsnitt C i bilaga 1 till Europaparlamentets och rådets direktiv 2004/39/EG av den 21 april 2004 om marknader för finansiella instrument och om ändring av rådets direktiv 85/611/EEG och 93/6/EEG och Europaparlamentets och rådets direktiv 2000/12/EG samt upphävande av rådets direktiv 93/22/EEG

TPF

1

FPT

, senast ändrat genom

Europaparlamentets och rådets direktiv 2006/31/EG

TPF

2

FPT

, får till och

med år 2010 efter tillstånd av Finansinspektionen överskrida de gränsvärden som anges i 7 kap.3 och 5 §§ lagen (2006:1371) om kapitaltäckning och stora exponeringar utan att beräkna något särskilt kapitalkrav enligt 7 kap. 8 § samma lag. Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om vilka villkor som skall vara uppfyllda för tillståndet.

Ett värdepappersbolag som tillhandahåller investeringstjänster eller utför investeringsverksamhet avseende sådana finansiella instrument som anges i 1 kap. 4 § första stycket 5 b–d, f och g lagen (2007:000) om värdepappersmarknaden, får till och med år 2010 efter tillstånd av Finansinspektionen överskrida de gränsvärden som anges i 7 kap.3 och 5 §§ lagen (2006:1371) om kapitaltäckning och stora exponeringar utan att beräkna något särskilt kapitalkrav enligt 7 kap. 8 § samma lag. Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om vilka villkor som skall vara uppfyllda för tillståndet.

9 §

Till och med år 2010 tillämpas inte bestämmelserna om kapitalkrav som avser värdepappersbolag i lagen (2006:1371) om kapitaltäckning och stora exponeringar

Till och med år 2010 tillämpas inte bestämmelserna om kapitalkrav som avser värdepappersbolag i lagen (2006:1371) om kapitaltäckning och stora exponeringar

TP

1

PT

EUT L 145, 30.4.2004, s. 1 (Celex 32004L0039).

TP

2

PT

EUT L 114, 27.4.2006, s. 60 (Celex 32006L0031).

Prop. 2006/07:115

238

för sådana värdepappersbolag vars huvudsakliga verksamhet är att tillhandahålla investeringstjänster avseende sådana finansiella instrument som anges i punkterna 5–7, 9 och 10 i avsnitt C i bilaga 1 till Europaparlamentets och rådets direktiv 2004/39/EG.

för sådana värdepappersbolag vars huvudsakliga verksamhet är att tillhandahålla investeringstjänster eller utföra investeringsverksamhet avseende sådana finansiella instrument som anges i 1 kap. 4 § första stycket 5 b–d, f och g lagen (2007:000) om värdepappersmarknaden.

U

Denna lag träder i kraft den 1 november 2007.

Prop. 2006/07:115

239

3 Ärendet och dess beredning

Europaparlamentet och Europeiska unionens råd har antagit direktivet 2004/39/EG av den 21 april 2004 om marknader för finansiella instrument och om ändring av rådets direktiv 85/611/EEG och 93/6/EEG och Europaparlamentets och rådets direktiv 2000/12/EG samt upphävande av rådets direktiv 93/22/EEG

TPF

1

FPT

(i det följande benämnt

MiFID), se bilaga 1. Till MiFID finns en rättelse som endast berör den svenska versionen, se bilaga 2. Därefter har Europeiska kommissionen (i det följande benämnd kommissionen) i enlighet med ett i direktivet föreskrivet kommittéförfarande antagit två rättsakter som kompletterar direktivet, se bilagorna 3 och 4. Dessa rättsakter är

– Kommissionens direktiv 2006/73/EG av den 10 augusti 2006 om genomförandet av Europaparlamentets och rådets direktiv 2004/39/EG vad gäller organisatoriska krav och villkor för verksamheten i värdepappersföretag, och definitioner för tillämpning av det direktivet

TPF

2

FPT

(i det följande benämnt genomförandedirektivet) och – Kommissionens förordning (EG) nr 1287/2006 av den 10 augusti 2006 om genomförande av Europaparlamentets och rådets direktiv 2004/39/EG vad gäller dokumenteringsskyldigheter för värdepappersföretag, transaktionsrapportering, överblickbarhet på marknaden, upptagande av finansiella instrument till handel samt definitioner för tillämpning av det direktivet

TPF

3

FPT

(i det följande benämnd

genomförandeförordningen). Regeringen beslutade den 23 juni 2004 att tillkalla en särskild utredare med bl.a. uppdrag att lämna förslag till hur direktivet skall genomföras i svensk rätt. Utredningen antog namnet Värdepappersmarknadsutredningen.

Utredningen har avgett betänkandena En ny lag om värdepappersmarknaden (SOU 2006:50) och supplement (SOU 2006:74). Sammanfattningen i betänkandet SOU 2006:50 och utredningens lagförslag finns i bilagorna 5 och 6.

Betänkandena har remissbehandlats. En förteckning över remissinstanserna och de som på eget initiativ yttrat sig finns i bilaga 7. Remissyttrandena finns tillgängliga i Finansdepartementet (dnr Fi2006/2506).

I bilaga 8 finns en uppställning som visar vilka bestämmelser som genomför MiFID och genomförandedirektivet i svensk rätt.

Lagrådet

Regeringen beslutade den 1 mars 2007 att inhämta Lagrådets yttrande över de lagförslag som finns i bilaga 9. Lagrådets yttrande finns i bilaga 10.

Regeringen har i propositionen, utom såvitt avser synpunkterna om hänvisningar i lagtext till olika EG-rättsakter (se avsnitt 4.5), i allt väsentligt följt Lagrådets förslag. Lagrådets synpunkter och förslag

TP

1

PT

EUT L 114, 27.4.2006, s. 60 (Celex 32006L0031).

TP

2

PT

EUT L 241, 2.9.2006, s. 26 (Celex 32006L0073).

TP

3

PT

EUT L 241, 2.9.2006, s. 1 (Celex 32006R1287).

Prop. 2006/07:115

240

behandlas i författningskommentaren och i avsnitten 8.4, 9.1.3, 9.2, 10.2 och 14.2.

Efter lagrådsföredragningen har dessutom vissa justeringar gjorts i 15 kap. 4 § och 25 kap. 9 § (i lagrådsremissen 25 kap. 14 §) lagen om värdepappersmarknaden samt i punkterna 7, 10 och 11 i övergångsbestämmelserna till lagen. Vidare har justeringar gjorts i 7 kap. 1 § lagen (1991:980) om handel med finansiella instrument, punkten 2 i ikraftträdande- och övergångsbestämmelserna till årsredovisningslagen (1995:1554) och lagen (1995:1559) om årsredovisning i kreditinstitut och värdepappersbolag (jfr prop. 2006/07:65), 10 kap.4 och 8 §§ lagen (2001:1227) om självdeklarationer och kontrolluppgifter, 10 § lagen (2005:377) om straff för marknadsmissbruk vid handel med finansiella instrument och 1 kap. 3 § lagen (2006:531) om särskild tillsyn över finansiella konglomerat. De nu nämnda justeringarna är av enklare beskaffenhet och regeringen bedömer att Lagrådets hörande över dem inte är nödvändig. Därutöver har vissa redaktionella ändringar gjorts i förhållande till lagrådsremissen. Vidare har i lagrådsremissen föreslagna ändringar i 3 kap.2 och 3 §§ lagen (2000:193) om Sjätte AP-fonden utgått och behandlas i stället i prop. 2006/07:100, i vilken 3 kap. 3 § upphävs.

Prop. 2006/07:115

241

4 Bakgrund

4.1 Direktivet om marknader för finansiella instrument (MiFID)

MiFID antogs den 21 april 2004, se bilaga 1. Direktivet ersätter rådets direktiv 93/22/EEG av den 10 maj 1993 om investeringstjänster inom värdepappersområdet (i fortsättningen benämnt ISD).

Bakgrunden till att kommissionen lade fram ett förslag till nytt direktiv på investeringstjänsteområdet var framför allt att ISD inte längre ansågs utgöra en effektiv ram för gränsöverskridande investeringar inom EU, se avsnitt 4.3. ISD ansågs vidare sakna tydliga grundläggande regler för hur konkurrensen mellan och konsolideringen av börser och andra handelsplatser skulle få gå till. En bakgrundsfaktor var också ökningen i antalet alternativ till konventionella finansierings- och sparformer som skett under senare år i form av en rad nya finansiella produkter och tjänster. Företag kan i ökad grad vända sig till aktiemarknader, riskkapitalbolag samt marknader för företagsobligationer för att få sina kapitalbehov tillgodosedda i stället för att använda sig av traditionella banklån. Hushåll kan placera sitt sparande i värdepapper, särskilt i värdepappersfonder och pensionsfonder, i stället för på bankkonton. Vidare har de finansiella marknaderna kommit att spela en alltmer väsentlig roll i företagens riskhantering. De finansiella marknaderna har följaktligen blivit en allt viktigare del av det finansiella systemet.

Liksom ISD innehåller MiFID bestämmelser om reglering och tillsyn av värdepappersföretag och om rätt för dessa företag att med stöd av sitt hemlandstillstånd bedriva gränsöverskridande verksamhet i andra medlemsstater. MiFID innebär dock en ökad harmonisering av reglerna för företagen och är betydligt mer omfattande och detaljerat än ISD. Direktivet har i vissa avseenden karaktär av s.k. minimiharmonisering, dvs. med utrymme att på nationell nivå anta strängare reglering. I andra avseenden liknar direktivet mer s.k. fullharmonisering, dvs. utan sådana möjligheter. På många områden framgår graden av harmonisering inte av direktivet, utan har lämnats för klarläggande i genomförandebestämmelser som antas av kommissionen.

Genom MiFID harmoniseras bl.a. reglerna för reglerade marknader. Direktivet innehåller bl.a. regler om auktorisation och krav på viss organisation. Vidare finns bestämmelser om vilka krav som skall gälla för att ett finansiellt instrument skall tas upp till handel på en reglerad marknad, och regler om tillträde till reglerade marknader. Direktivet innehåller även vissa begränsade bestämmelser om clearing och avveckling av transaktioner i finansiella instrument, bl.a. om vilka möjligheter en aktör har att välja system. För en sammanfattande beskrivning av bestämmelserna i MiFID, se SOU 2006:50 s. 85 ff.

Prop. 2006/07:115

242

4.2 Kommissionens genomförandebestämmelser

Lamfalussymodellen

Kommissionen presenterade i maj 1999 en handlingsplan för finansiella tjänster, kommissionens meddelande Att genomföra handlingsramen för finansmarknaderna: En handlingsplan, KOM (1999) 232. Handlingsplanen syftade till att skapa en integrerad marknad för finansiella tjänster i EU och innehöll 42 förslag till åtgärder. Europeiska rådet och Europaparlamentet gav sitt stöd åt handlingsplanen. Enligt tidsplanen skulle åtgärderna vara genomförda senast 2005. Inom denna tidsram hade 39 av de 42 åtgärderna genomförts på gemenskapsnivå, däribland MiFID.

Mot bakgrund av bl.a. de korta tidsfristerna för att genomföra handlingsplanen för finansiella tjänster togs en ny modell fram för lagstiftning på värdepappersmarknadsområdet. I en rapport som presenterades i februari 2001, föreslog den s.k. visemannakommittén en ny lagstiftningsmodell på värdepappersmarknadsområdet (rapporten kallas ”Lamfalussyrapporten” efter kommitténs ordförande, Alexandre Lamfalussy). Den modell som kommittén föreslog, Lamfalussymodellen, syftar till att möjliggöra ett snabbare lagstiftningsförfarande och en mer flexibel lagstiftning. Modellen delar in regelgivningen och uppföljningen i fyra nivåer.

På nivå ett fastställs allmänna principer enligt det normala lagstiftningsförfarandet inom EG-rätten, dvs. genom direktiv eller förordningar som föreslås av kommissionen och antas av rådet och Europaparlamentet. I dessa rättsakter delegeras åt kommissionen att utfärda genomförandebestämmelser i vissa hänseenden.

På nivå två antar kommissionen genomförandebestämmelser för att fylla ut eller anpassa de allmänna principer som beslutats på nivå ett. Dessa bestämmelser kan vara i form av såväl direktiv som förordningar. Kommissionen biträds i detta arbete av en kommitté, europeiska värdepapperskommittén (European Securities Committee, ESC), bestående av företrädare för medlemsstaterna. Kommittén är en föreskrivande kommitté enligt artikel 5 i 1999 års kommittologibeslut

TPF

4

FPT

.

Nivå tre omfattar ett utökat samarbete mellan medlemsstaternas tillsynsmyndigheter för värdepappersmarknaderna. Samarbetet syftar bl.a. till att de bestämmelser som beslutats på nivåerna ett och två genomförs i lagstiftningen i de olika medlemsstaterna på ett konsekvent och likvärdigt sätt. På nivå tre finns en rådgivande kommitté, europeiska värdepapperstillsynskommittén (Committee of European Securities Regulators, CESR) som bl.a. har till uppgift att vägleda kommissionen vid utarbetande av genomförandebestämmelser.

Slutligen skall kommissionen på nivå fyra ta ett ökat ansvar för att säkerställa att gemenskapslagstiftningen genomförs i medlemsstaterna på ett likartat sätt.

Lamfalussymodellen antogs av rådet i mars 2001 och har därefter även antagits av Europaparlamentet. Tillämpningsområdet utvidgades år 2006

TP

4

PT

Rådets beslut 1999/468/EG av den 28 juni 1999 om de förfaranden som skall tillämpas

vid utövandet av kommissionens genomförandebefogenheter, EGT L 184, 17.7.1999, s. 23 (Celex 31999D0468).

243

Prop. 2006/07:115 till att omfatta även lagstiftning inom bank-, försäkrings- och fondområdena.

Genomförandebestämmelser till MiFID

MiFID har arbetats fram med Lamfalussymodellen som utgångspunkt. Därmed har det också på ett tidigt stadium stått klart att direktivet skulle komma att kompletteras med genomförandebestämmelser på nivå två.

Den 20 januari 2004, dvs. redan innan MiFID officiellt antagits, ingav kommissionen en preliminär begäran till CESR om tekniska råd avseende genomförandebestämmelser på en rad avsnitt i direktivet, (det s.k. första mandatet). Den 25 juni 2004 kompletterade kommissionen denna preliminära begäran med en formell begäran om ytterligare tekniska råd från CESR, (det s.k. andra mandatet).

CESR överlämnade i slutet av januari 2005 en första uppsättning tekniska råd till kommissionen som svar på det första mandatet. I början av maj 2005 överlämnades en andra uppsättning tekniska råd i respons på det andra mandatet samt på ett antal kvarvarande frågor från det första mandatet för vilka svarstiden hade förlängts.

Kommissionen och ESC har med utgångspunkt från CESR:s tekniska råd i ett antal arbetsdokument arbetat fram utkast till genomförandebestämmelser.

Kommissionen har, efter omröstning i ESC, därefter antagit genomförandebestämmelser i form av ett direktiv (genomförandedirektivet) och en förordning (genomförandeförordningen), se bilaga 2 och 3.

4.3 ISD

Bakgrund

I samband med att ISD antogs 1993 blev reglerna om värdepappersinstitut och handeln med finansiella instrument mer harmoniserade inom EU. Direktivet avsåg att förverkliga den inre marknaden på värdepappersområdet och innehåller minimiregler om kraven på verksamheten i värdepappersinstitut.

ISD innehåller bl.a. en förteckning över de tjänster, s.k. investeringstjänster, som skall vara tillståndspliktiga i medlemsstaterna och för vilka direktivets bestämmelser gäller. Med investeringstjänster avses bl.a. att verkställa kunders order om köp eller försäljning av finansiella instrument och att förvalta någon annans finansiella instrument.

ISD bygger på principen om hemlandsauktorisation, dvs. ett institut som har auktorisation i sitt hemland får med stöd av denna erbjuda sina tjänster i andra medlemsstater, genom etablering av filial eller genom gränsöverskridande verksamhet, utan att krav på ytterligare tillstånd får ställas. Med stöd av hemlandsauktorisationen kan ett institut också kräva att få tillträde till börser och andra reglerade marknader i andra medlemsstater samt till marknaderna anslutna clearing- och avvecklingssystem.

Prop. 2006/07:115

244

Ansvaret för tillsynen över ett värdepappersinstituts verksamhet ligger i princip på myndigheterna i institutets hemland, även i fråga om verksamhet som bedrivs i andra länder. I direktivet finns särskilda regler om uppdelning av ansvar och samverkan mellan berörda tillsynsmyndigheter.

Brister i ISD

Som berörts ovan uppmärksammades ett antal brister i ISD och i nationell lagstiftning grundad på direktivet.

För det första ansågs inte direktivet medföra en tillräckligt hög grad av harmonisering för att möjliggöra ett effektivt ömsesidigt erkännande av värdepappersföretags tillstånd. Den ofta flerdubbla tillsynen av gränsöverskridande transaktioner ansågs hämma effektiviteten i det Europapass som infördes genom ISD.

För det andra ansågs ISD:s bestämmelser om skydd för investerarna vara omoderna och behöva uppdateras för att ta hänsyn till nya affärsalternativ och ny marknadspraxis och de risker som sammanhänger med dessa. Reglerna ansågs också behöva ses över för att tvinga de företag som handlar på investerarnas vägnar att aktivt dra nytta av nya handelsalternativ för att ge kunden bästa möjliga resultat. Därmed skulle konkurrensen mellan olika typer av transaktionskanaler gynna slutinvesteraren.

För det tredje omfattade ISD inte heller hela utbudet av investeringstjänster och finansiella instrument. En del av dessa tjänster ansågs kunna innebära betydande risker för investerarna eller marknadseffektiviteten, speciellt om de utgjorde företagets huvudsakliga verksamhet.

För det fjärde ansågs ISD inte ge tillfredsställande behandling av de reglerings- och konkurrensfrågor som uppstod när börser i ökad omfattning började konkurrera med varandra och med nya handelsplattformar. När ISD antogs förekom konkurrens mellan börserna och handelssystemen endast i tämligen begränsad omfattning. Att reglera konkurrensen mellan olika metoder för orderutförande (börser, nya handelsplattformar, orderutförande av värdepappersföretagen själva) sågs som en viktig utmaning. De få och knapphändiga bestämmelser i ISD som gällde reglerade marknader ansågs inte ge en tillräcklig ram inom vilken marknader och system kunde konkurrera om likviditeten och inom vilken värdepappersföretag kunde utföra order utanför börserna i samband med att de tillhandahöll andra tjänster till kunderna.

Ett annat problem var att ISD gav medlemsstaterna valfrihet att föreskriva att order från privata investerare endast skulle få utföras på en reglerad marknad (”koncentrationsregeln”). Denna möjlighet hade utnyttjats av vissa medlemsstater, medan andra valt att inte göra det. Detta hade lett till att metoderna för orderutförande skiljde sig åt mer i de senare länderna. Dessa grundläggande skillnader i regleringen av marknadsstrukturen hade i sin tur lett till skillnader mellan medlemsstaterna i fråga om handelskonventioner, regler om hur handeln på marknaden skall bedrivas, utrymmet för konkurrens mellan olika plattformar för orderutförande samt marknadsaktörernas beteende. Enligt

rop. 2006/07:115

245

P kommissionen kunde dessa skillnader utgöra ett hinder för gränsöverskridande transaktioner.

Vidare ansågs ISD:s bestämmelser om bl.a. samarbete mellan behöriga myndigheter vara otillräckligt utvecklade. De ansågs exempelvis inte vara tillräckligt tydliga när det gäller fördelningen av tillsynsansvaret mellan medlemsstaterna och ansågs heller inte lägga en bra grund för gränsöverskridande samarbete mellan tillsynsmyndigheterna. Enligt kommissionen krävdes det att olagligt beteende beivrades och bestraffades med samma kraft i hela unionen för att en fullständigt integrerad inre marknad för finansiella tjänster skall fungera. Ytterligare ett villkor för att en integrerad och organiserad inre marknad skulle fungera ansågs vara att det fanns ett smidigt samarbete och informationsflöde mellan de nationella myndigheterna. Bestämmelserna i ISD om samarbete mellan tillsynsmyndigheterna utformades för en miljö där kopplingarna mellan olika nationella finansiella marknader inte var lika utvecklade. Enligt kommissionens mening fanns det därför behov av att modernisera dessa bestämmelser.

Slutligen ansågs bestämmelserna i ISD inte vara tillräckligt flexibla och moderna. De ansågs vara illa anpassade för angelägna regleringsfrågor som orsakats av förändringar i marknadsstrukturen och affärs- och tillsynsmetoderna.

4.4 Öppenhetsdirektivet

Den 31 december 2004 publicerades Europaparlamentets och rådets direktiv 2004/109/EG av den 15 december 2004 om harmonisering av insynskraven angående upplysningar om emittenter vars värdepapper är upptagna till handel på en reglerad marknad och om ändring av direktiv 2001/34/EG (i fortsättningen benämnt öppenhetsdirektivet). Direktivet syftar till att förbättra såväl skyddet för investerarna som effektiviteten på värdepappersmarknaderna. Direktivet trädde i kraft den 20 januari 2005 och bestämmelserna skall enligt direktivet vara genomförda i medlemsstaternas lagstiftning senast den 20 januari 2007.

Öppenhetsdirektivet innebär i stora delar en modernisering av de regler som finns i Europaparlamentets och rådets direktiv 2001/34/EG av den 28 maj 2001 om upptagande av värdepapper till officiell notering och om uppgifter som skall offentliggöras beträffande sådana värdepapper. Det direktivet är i sin tur en s.k. kodifiering av fyra äldre direktiv.

Öppenhetsdirektivet innehåller huvudsakligen bestämmelser om vilken information som skall offentliggöras av ett företag som har gett ut värdepapper som är upptagna till handel på en reglerad marknad, t.ex. ett börsnoterat aktiebolag. Bland dessa bestämmelser kan nämnas krav på att emittenten inom vissa tider skall offentliggöra regelbunden finansiell information (t.ex. årsredovisning och delårsrapport) samt att vissa ändringar i rättigheter knutna till de värdepapper som har emitterats skall offentliggöras. Vidare innehåller direktivet regler om information till, och behandling av, innehavare av värdepapper som är upptagna till handel vid en reglerad marknad. Bland dessa regler kan nämnas krav på hur aktieägare skall informeras inför en bolagsstämma. Direktivet innehåller också bestämmelser om information som bl.a. den som äger en

246

Prop. 2006/07:115 större aktiepost skall lämna till aktiebolaget när storleken på aktieinnehavet förändras och krav på att denna information skall offentliggöras.

Genom direktivet införs s.k. hemlandstillsyn. Detta innebär att det för varje företag är ett land inom Europeiska ekonomiska samarbetsområdet, EES, som skall ha huvudansvaret för tillsynen av att direktivets bestämmelser följs. Varje land skall utse en behörig myndighet som skall ansvara för tillsynen. Direktivet medger dock att denna myndighet delegerar vissa uppgifter. Det är också möjligt att för viss kontroll utse en annan myndighet.

All information som skall offentliggöras enligt direktivet skall också ges in till den behöriga myndigheten. I varje land måste det också finnas minst en central lagringsfunktion för informationen.

Direktivet är ett s.k. minimidirektiv, dvs. medlemsstaterna får införa strängare regler än vad som följer av öppenhetsdirektivet för de företag som staten utövar tillsyn över och för aktieägare i sådana bolag. Däremot får en medlemsstat inte uppställa strängare krav än öppenhetsdirektivet för emittenter som någon annan medlemsstat har tillsynsansvaret för.

4.5 Hänvisningar till EG-rättsakter

I lagtext förekommer i vissa fall hänvisningar till olika EG-rättsakter. Lagrådet har i sitt yttrande anfört att det i varje sammanhang när det i svensk lagstiftning hänvisas till en sådan rättsakt bör klargöras vilken lydelse av rättsakten som åsyftas. De hänvisningar som finns till EGrättsakter i regeringens förslag till lagtext har utformats på det sätt som är brukligt i svenska författningar, dvs. de följer de riktlinjer för författningsskrivning som finns inom Regeringskansliet. För hänvisningar till EG-direktiv gäller därvid att man första gången som ett direktiv nämns i en författning skriver ut direktivets fullständiga namn. Om direktivet har ändrats skall detta anges. Avsikten är således att hänvisningen skall avse det aktuella direktivet i den lydelse som direktivet har när lagen antas av riksdagen. Eventuella senare ändringar av direktivet som på ett materiellt sätt påverkar lagstiftningen kräver följaktligen en lagändring.

För EG-förordningar framgår av gällande riktlinjer att någon hänvisning till att förordningen har ändrats inte behöver göras i lagtext. En förordning är direkt gällande som svensk rätt. Att som Lagrådet föreslagit alltid ange vilken lydelse av förordningen som åsyftas vid hänvisningar i lagtext kan därför möjligen bli missvisande, eftersom läsaren kan förledas att tro att det enbart är förordningen i en viss lydelse som är tillämplig. Även om det inte kan uteslutas att det finns fall då det är motiverat att i lagtexten ange att en förordning, eller en del av en förordning, är tillämplig i en viss lydelse är vår bedömning att detta inte är fallet i detta lagstiftningsärende. Det kan diskuteras om det etablerade sättet att formulera hänvisningar till EG-rättsakter är det lämpligaste och tydligaste. Frågan kräver emellertid ytterligare utredning innan regeringen kan ta ställning till om hänvisningar i framtiden bör formuleras på ett annat sätt än i dag.

Prop. 2006/07:115

247

4.6 Gällande bestämmelser på värdepappersområdet

Regleringen på värdepappersmarknadsområdet är omfattande. Förutom genom lagar och förordningar regleras marknaden genom myndighetsföreskrifter, interna marknadsplatsregler, allmänna avtalsvillkor och rekommendationer från branschorgan m.m. Regleringen är sedan början av 1990-talet i stor utsträckning baserad på EG-rätten. På grund av det stora antalet nya bestämmelser som tillkommit inom EU under senare år har lagstiftningen vuxit i omfattning och blivit allt mer svåröverskådlig.

Lagen (1992:543) om börs- och clearingverksamhet innehåller bestämmelser om börser, börsmedlemmar (dvs. deltagarna i handeln vid en börs), auktoriserade marknadsplatser, clearingorganisationer, handelsstopp och tillsyn. Den huvudsakliga regleringen för värdepappersinstitutens verksamhet finns i lagen (1991:981) om värdepappersrörelse. I denna lag finns bestämmelser bl. a. om vad som krävs för att tillstånd att driva värdepappersrörelse skall lämnas, vilka krav som värdepappersbolagen fortlöpande måste uppfylla samt hur och under vilka förutsättningar som tillsynsmyndigheten kan ingripa mot institutens verksamhet.

Lagen (1991:980) om handel med finansiella instrument innehåller bestämmelser bl.a. om krav på att upprätta prospekt vid vissa emissioner och andra erbjudanden om köp och försäljning av finansiella instrument. Lagen innehåller även bestämmelser om anmälningsskyldighet för förvärv som innebär att ett innehav uppnår vissa nivåer (s.k. flaggningsskyldighet). Vidare innehåller lagen definitioner av begreppen finansiellt instrument och fondpapper som har betydelse för övrig lagstiftning som rör värdepappersmarknaden. Med finansiellt instrument avses fondpapper och annan rättighet eller förpliktelse som är avsedd för handel på värdepappersmarknaden. Fondpapper definieras i sin tur som aktie och obligation samt sådana andra delägarrätter eller fordringsrätter som är utgivna för allmän omsättning, fondandel och aktieägares rätt gentemot den som för hans räkning förvarar aktiebrev i ett utländskt bolag (depåbevis). Finansiellt instrument är således ett vidare begrepp än fondpapper. Exempel på finansiella instrument som inte utgör fondpapper är främst olika former av derivat. Dessa är i stället hänförliga till andra rättigheter och förpliktelser som är avsedda för handel på värdepappersmarknaden och som därför också omfattas av begreppet finansiellt instrument.

De ovan angivna lagarna innehåller de grundläggande bestämmelserna i förhållande till MiFID. Finansinspektionen har efter bemyndigande i förordningen (1991:1007) om handel och tjänster på värdepappersmarknaden och förordningen (1992:561) om börs- och clearingverksamhet meddelat ett stort antal föreskrifter på området. Därutöver har Finansinspektionen gett ut allmänna råd. Dessa råd är i och för sig inte bindande men torde kunna tillmätas betydelse bl.a. vid tillståndsprövning och i skadeståndssammanhang.

Förutom lagar, förordningar och myndighetsföreskrifter finns som redan nämnts en omfattande självreglering på området. Börser ställer upp villkor och krav i sina noteringsavtal och avtal med börsmedlemmarna. Motsvarande gäller för auktoriserade marknadsplatser. Vidare har olika branschorgan, t.ex. Näringslivets börskommitté, Svenska Fondhandlare-

Prop. 2006/07:115

248

föreningen och Fondbolagens Förening genom rekommendationer och riktlinjer skapat ett internt regelverk som vunnit allmän efterföljd på marknaden. Aktiemarknadsnämnden skall också genom uttalanden, rådgivning och information verka för god sed på aktiemarknaden.

MiFID påverkar framför allt den svenska lagregleringen avseende värdepappersrörelse och marknadsplatser i lagen om värdepappersrörelse och lagen om börs- och clearingverksamhet. För en kortfattad beskrivning av de viktigaste bestämmelserna i dessa två lagar, se betänkande SOU 2006:50 s. 67 ff. MiFID påverkar även lagen (1914:45) om kommission, vilket behandlas i avsnitt 13.1.3.

Prop. 2006/07:115

249

5 Handeln med finansiella instrument i Sverige

I detta avsnitt beskrivs kortfattat handeln med finansiella instrument i Sverige. Bland annat redogörs för hur handeln på de olika finansiella marknaderna för närvarande är organiserad, de huvudsakliga aktörerna och grundläggande begrepp (se betänkandet, SOU 2006:50 avsnitt 4, för en utförligare beskrivning).

En stor del av bestämmelserna i MiFID är inriktade mot aktiehandeln som behandlas i ett inledande avsnitt (5.1). Därpå följer redogörelser för handeln med räntebärande instrument (5.2), för värdepappersinstituten i Sverige (5.3) och den finansiella elmarknaden (5.4).

5.1 Handeln med aktier

5.1.1 Aktiehandeln på Stockholmsbörsen

Den övervägande delen av handeln med svenska aktier sker över Stockholmsbörsen. Vid sidan av handeln på Stockholmsbörsen organiseras aktiehandel även lokalt hos värdepappersinstitut och på några mindre marknadsplatser. Sedan oktober 2006 ingår aktierna som handlas på Stockholmsbörsen i en nordisk lista, som ett konkret uttryck för ambitionen att integrera handeln med aktier i Norden.

All handel på Stockholmsbörsen sker genom börsens medlemmar. Såväl stora som små investerare måste gå via någon av dessa medlemmar för att köpa eller sälja aktier. Börsmedlemmarna består dels av svenska värdepappersinstitut (värdepappersbolag och kreditinstitut som har Finansinspektionens tillstånd att bedriva värdepappersrörelse), dels av s.k. fjärrmedlemmar (utländska företag som bedriver börshandel i Sverige). Vid utgången av 2006 uppgick antalet medlemmar vid Stockholmsbörsen till 87, varav ett femtiotal fjärrmedlemmar.

Handelsstruktur

En stor del av aktiehandeln i Sverige sker genom matchning av order i Stockholmsbörsens elektroniska handelssystem SAXESS. Systemet består av en centraldator med anslutna arbetsstationer placerade hos medlemmarna. De auktoriserade mäklare som har tillträde till arbetsstationerna kan kontinuerligt följa vad som händer på marknaden, t.ex. vilka order som har lagts in och vilka avslut som görs.

Sedan en köpare eller säljare av aktier har lämnat en köp- eller säljorder till sitt värdepappersinstitut vidarebefordras ordern till en mäklare som lägger in denna i handelssystemets orderbok. Många börsmedlemmar tillhandahåller kunder tjänster för orderläggning via Internet utan inslag av rådgivning, vilket oftast innebär lägre transaktionskostnader än handel som går via värdepappersinstitut.

En order kan antingen läggas in i systemet som en s.k. limitorder, med angivande av högsta köpkurs eller lägsta säljkurs, eller som en s.k. marknadsorder där mäklaren får uppdraget att utföra ordern till bästa tillgängliga kurs. I orderboken sorteras limitorder efter pris och tidpunkt. Den högsta köp- respektive lägsta säljkursen hamnar högst upp i

Prop. 2006/07:115

250

orderboken (primär prioritet). Om priset är detsamma för flera order sorteras de i tidsordning (sekundär prioritet). Tiden för hur länge en order ligger i systemet beror på förekomsten av andra order som kan läggas till grund för avslut. Innan en marknadsorder når det automatiska handelssystemet har den dock hanterats av en mäklare som bedömer när hela eller delar av ordern skall läggas in.

En avvikelse från tidsordningen gäller när en och samma medlem lagt in både en köporder och en säljorder för samma aktie i systemet. I detta fall matchas dessa order mot varandra, utan avseende på var i turordningen de befinner sig. Detta gäller såväl limitorder som marknadsorder. Det finns också en rad handelsregler, exempelvis för att hantera order som kan verka störande för handeln, som innebär att de inte nödvändigtvis exekveras. Vidare finns det rutiner som innebär att avslut som genomförts i strid med börsens regler kan makuleras.

Efter avslut skickas information om genomförda transaktioner till VPC AB, där affärerna avvecklas. En transaktion är inte fullt genomförd innan säljaren levererat sålda värdepapper och köparen mottagit köpta värdepapper, i båda fallen i utbyte mot likvid. Denna process kallas clearing och avveckling och hanteras i Sverige av VPC som även är central värdepappersförvarare eller kontoföringsinstitut. VPC fullgör även motsvarande funktioner när det gäller räntebärande instrument. Den finländska värdepapperscentralen, APK, ägs i dag till 100 procent av VPC, som i sin tur ägs till 99 procent av de fyra svenska storbankerna (Svenska Handelsbanken, Nordea, SEB och Swedbank).

Avveckling innebär att aktierna avregistreras från säljarens avstämningskonto och registreras på köparens (om kunden har en depå hos en mäklare registreras transaktionen i stället på depåhållarens förvaltarkonto i VPC). Samtidigt sker betalning via köparens och säljarens banker enligt principen om betalning mot leverans. Först när detta är gjort, är affären slutgiltigt genomförd (vanligen tre dagar efter avslut).

Även om limitorder och marknadsorder är de enda typer av order som förekommer i börsens handelssystem finns det varianter av hur dessa exekveras. Det är exempelvis inte ovanligt att institutionella kunder vill att en större order portioneras ut i systemet i mindre poster, framför allt för att undvika alltför kraftiga förändringar i prisbilden. Det finns då en möjlighet för mäklaren att i börsens handelssystem lägga s.k. isbergsorder, där endast en del av den totala orderstorleken (”toppen av isberget”) är synlig för andra aktörer. När en delpost är exekverad, läggs automatiskt nästa delpost ut i systemet till dess hela ordern är utförd.

Det kan även förekomma andra typer av order än rena limitorder eller marknadsorder som därmed inte kan läggas in i börsens system i sin helhet, exempelvis s.k. VWAP-order (Volume Weighted Average Price). I en VWAP-order sker prissättningen gentemot kunden på grundval av ett vägt genomsnitt av priserna i samtliga transaktioner som har genomförts under dagen i det aktuella värdepapperet. I MiFID beskrivs denna typ av order som ett avslut som är förenat med andra villkor än aktiens aktuella marknadspris (artikel 27.3 femte stycket i MiFID och artikel 18.1 b i genomförandeförordningen).

Prop. 2006/07:115

251

Emittenter

Vid utgången av 2006 var 276 bolag inregistrerade eller noterade på Stockholmsbörsen (i det följande används begreppet ”noterad” för både inregistrerade och noterade börsbolag). De bolag som vill bli noterade på börsen måste förbinda sig att förse marknaden med information om beslut och händelser som kan ha kurspåverkande effekt. Skälet är att alla som handlar med bolagens aktier skall ha tillgång till samma information.

Genom införandet av den gemensamma nordiska börslistan i oktober 2006 försvann den tidigare uppdelningen i Stockholmsbörsens A-lista respektive O-lista (bolag som tidigare låg på O-listan och är befriade från förmögenhetsskatt markeras med asterisk i den nordiska börslistan). Den nordiska börslistan innebär bl.a. en harmonisering av noteringskraven. Bland de finansiella kraven för notering, enligt Noteringskrav för den nordiska börsen (OMX, oktober 2006), märks bl.a. att aktiernas förväntade marknadsvärde skall uppgå till minst en miljon euro, att ägandet skall vara tillräckligt spritt (normalt 25 procent av aktiekapitalet fördelat på minst 500 aktieägare som vardera äger aktier värda åtminstone 1 000 euro) och att det skall finns en tillräckligt lång historik (tre år) och stabil lönsamhet, alternativt finansiella resurser för minst tolv månaders verksamhet.

Anskaffning av nytt kapital på börsen kan ske antingen genom nyemissioner, dvs. befintliga börsbolag som ökar aktiekapitalet genom att ge ut nya aktier, eller genom att nya bolag introduceras på börsen. Under 2006 anskaffades totalt cirka 15 miljarder kronor på detta sätt, varav drygt hälften avsåg nyintroduktioner (sammanlagt tillkom 21 bolag).

Placerare

Aktieägandet i Sverige är spritt och omfattande. Det samlade marknadsvärdet av aktier i bolag som var noterade på en svensk marknadsplats uppgick till 4 425 miljarder kronor vid utgången av 2006. Av detta utgjorde 14,3 procent de svenska hushållens direkta aktieinnehav. De finansiella institutionernas andel av aktieägandet uppgick vid samma tillfälle till 30,2 procent, varav de statliga AP-fonderna och PPM svarade för 3,2 procentenheter. De ickefinansiella företagens andel var 9,0 procent. Under 1990-talet ökade utlandsägandet på Stockholmsbörsen kraftigt. Vid utgången av 2006 uppgick utlandsandelen till 37,2 procent av det samlade börsvärdet, den högsta andel som noterats sedan 2000. Resten (9,3 procent) utgjordes av statens direktägande (4,5 procent), kommuner (0,1 procent) samt ickevinstdrivande organisationer (4,8 procent).

Omsättning och marknadsvärde

Den årliga omsättningen i handeln med aktier på Stockholmsbörsen har uppvisat en långsiktigt stigande trend, även med beaktande av att börsvärdet för summan av handlade aktier också stiger. Sedan 2000 har den årliga omsättningen i handeln med aktier på Stockholmsbörsen

Prop. 2006/07:115

252

överstigit börsens genomsnittliga marknadsvärde under respektive år, vilket innebär att den genomsnittliga tiden för innehav av en svensk aktie understiger ett år. Den s.k. omsättningshastigheten, som är kvoten mellan omsättning och genomsnittligt marknadsvärde, uppgick för tio år sedan till två tredjedelar av börsvärdet, och har sedan 2001 överstigit 120 procent av marknadsvärdet, vilket innebär en motsvarande förkortning av den genomsnittliga tiden för innehav av en svensk aktie som nu kan uppskattas till mellan åtta och tio månader. Under 2006 uppgick omsättningen till 5 521 miljarder kronor eller 22,0 miljarder kronor per dag, vilket motsvarade en omsättningshastighet över 146 procent. Vid slutet av året uppgick Stockholmsbörsens marknadsvärde till 4 275 miljarder kronor.

5.1.2 Den nordiska börslistan

Aktiehandeln inom Norden och Baltikum har alltmer kommit att integreras. Ett konkret uttryck för det är den gemensamma nordiska börslista som OMX lanserade den 2 oktober 2006. Listan omfattar alla bolag som listats på börserna i Stockholm, Helsingfors och Köpenhamn och ersätter tidigare nationella listor (exempelvis de svenska A- och Olistorna). Listan omfattade från starten 580 bolag, fördelade på 120 stora bolag med ett börsvärde överstigande en miljard euro (large cap), 175 mellanstora bolag med ett mindre börsvärde (mid cap) och 285 småbolag med ett börsvärde understigande 150 miljoner euro (small cap). Enligt uppgift från OMX skall listan under 2007 kompletteras med isländska företag och längre fram även med baltiska företag.

Inom ramen för det s.k. NOREX-samarbetet tillämpas en rad gemensamma regler för börshandeln i Danmark, Estland, Finland, Island, Lettland, Litauen, Norge och Sverige. Dessutom används samma aktiehandelssystem – SAXESS – på börserna i dessa länder.

Stockholmsbörsen drivs av OMX Exchanges, som är ett helägt dotterbolag till OMX AB. OMX ägdes vid slutet av 2005 till 72,7 procent av svenska institutioner. Andelen utländskt ägande uppgick vid det tillfället till 18,5 procent. Av bokslutskommunikén framgår att utlandsägandet ett år senare hade ökat till 41,5 procent och att det inhemska ägandet således minskat betydligt. Börsverksamheten drivs organisatoriskt i huvudsak inom affärsområdet OMX Nordic Market Places och kommuniceras externt under det gemensamma namnet ”Den Nordiska Börsen”. OMX äger och driver, förutom Stockholmsbörsen, även börserna i Helsingfors, Köpenhamn, Reykjavik, Tallinn, Riga och Vilnius samt värdepapperscentralerna i Estland, Lettland och Island.

Vid utgången av 2006 var totalt 712 bolag noterade på de av OMX ägda börserna. Totalt fanns det 159 medlemmar, exklusive 137 medlemskap vid fler än en börs. Den sammanlagda aktieomsättningen på de börser som under 2006 ingick i OMX Exchanges uppgick under året till i genomsnitt 38,8 miljarder kronor per dag, varav Stockholmsbörsen svarade för drygt hälften. Det totala marknadsvärdet för alla noterade bolag på OMX Exchanges uppgick vid slutet av 2005 till 8 435 miljarder kronor, varav värdet av bolagen på Stockholmbörsen utgjorde hälften.

Prop. 2006/07:115

253

5.1.3 Annan börs

Utöver Stockholmsbörsen har också Nordic Growth Market (NGM) AB tillstånd av Finansinspektionen att driva börs i Sverige. NGM har specialiserat sig på mindre tillväxtbolag och erbjuder notering och aktiehandel på listorna NGM Official och NGM Equity samt derivathandel på listan Nordic Derivatives Exchange (NDX). På NGM Equity handlades vid utgången av 2006 53 instrument, varav 44 utgjorde noterade aktier. Under året var omsättningen i handeln 13,3 miljarder kronor, en ökning jämfört med 9,2 miljarder kronor under föregående år.

5.1.4 Auktoriserad marknadsplats

I svensk lagstiftning har hittills även funnits begreppet auktoriserad marknadsplats. En auktoriserad marknadsplats fungerar i allt väsentligt som en börs, men har inte samma krav när det gäller styrelsens sammansättning och inrättande av en disciplinnämnd som en börs. Dessutom är kraven något mindre långtgående i fråga om kursnotering, information och rapportering. I nuläget finns det inte något företag som driver verksamhet som auktoriserad marknadsplats i Sverige.

5.1.5 Annan organiserad handel

Det sker även inofficiell handel i mindre bolags aktier, som inte är noterade på en börs eller auktoriserad marknadsplats. Sådan handel benämns ibland listhandel och organiseras av företag med tillstånd att driva värdepappersrörelse. Det har på senare tid även uppstått former för handeln som utformats med ledning av MiFID och den nya lagstiftning på området som följer av detta direktiv. Den handel som sker på BeQuoteds inofficiella aktielista och Göteborgs OTC-lista är exempel på det förra medan First North och Nordic MTF är ett exempel på det senare.

First North bestod till och med 2006 av två listor som drevs av Köpenhamnsbörsen respektive Stockholmsbörsen enligt respektive marknadsplats egna regler och med särskilt tillstånd för börserna att driva sidoverksamhet. Från och med 2007 ingår även den isländska alternativa marknaden isec. De bolag som handlas på First North i Stockholm är inte noterade på Stockholmsbörsen men handeln sker genom Stockholmsbörsens handelssystem SAXESS. Information om kurser, volymer och orderdjup offentliggörs i realtid genom samma kanaler som gäller för börsaktier. Förutom den övervakning av handeln som ombesörjs av Stockholmsbörsen har varje bolag en certifierad rådgivare som enligt avtal med Stockholmsbörsen ansvarar för att bolaget uppfyller kraven för att handlas på First North och fortlöpande följer de informationskrav som gäller. Av regelverket (daterat 2006-08-09) framgår OMX avsikt att First North skall drivas som MTF när detta blir möjligt. Vid utgången av 2006 var 79 bolag listade på First North, varav 69 bolag i Stockholm, med ett sammanlagt marknadsvärde uppgående till 38,3 miljarder kronor. Omsättningen under året var 41,5 miljarder kronor.

Prop. 2006/07:115

254

AktieTorget AB som tidigare drev verksamhet som auktoriserad marknadsplats har fr.o.m. den 29 mars 2007 övergått till att vara ett värdepappersbolag. Företaget driver dock fortfarande organiserad handel med värdepapper. Handeln sker genom Stockholmsbörsens handelssystem SAXESS. AktieTorget AB ägs helt av AktieTorget Holding AB, som i sin tur ägs av Stiftelsen Lokal Aktiehandel samt ett antal fysiska personer. På marknadsplatsen handlas framför allt s.k. tillväxtaktier i mindre bolag. I november 2006 handlades 56 bolag på AktieTorget.

Andra exempel på organiserad handel som inte motsvarar begreppen börs eller auktoriserad marknadsplats är Nordic MTF (tidigare Nordic OTC), där handeln upprätthålls av sponsorer genom NGM:s system (sammanlagt 15 bolag i november 2006), BeQuoteds inofficiella aktielista (32 bolag i november 2006) är ett annat exempel, liksom Göteborgs OTC-lista som drivs av Thenberg & Kinde Fondkommission (fem bolag i november 2006).

5.1.6 Handeln med aktierelaterade derivat

Stockholmsbörsen tillhandahåller integrerad handel och clearing av standardiserade optioner och terminer baserade på svenska och vissa utländska aktier. Dessutom handlas derivatkontrakt med börsens index som underliggande tillgång, exempelvis OMXS30-optioner och OMXS30-terminer, vilka avvecklas genom kontantavräkning. Handeln bedrivs i en gemensam orderbok, i vilken även medlemmar på Oslo Börs respektive EDX London kan delta. Vidare tillhandahåller börsen en OTC-clearing av derivatkontrakt som inte är upptagna till handel.

En aktieoption är ett kontrakt där innehavaren har rätten, men inte skyldigheten, att köpa eller sälja en aktie fram till eller vid en given tidpunkt i framtiden till ett förutbestämt pris. Utfärdaren av samma option har i sin tur skyldigheten men inte rätten att genomföra affären om innehavaren väljer att utnyttja sin rätt. En aktietermin är ett kontrakt där köpare och säljare har förbundit sig att vid en given framtida tidpunkt köpa respektive sälja en viss aktie till ett i förväg fastställt pris.

Förutom handeln med standardiserade aktie- och aktieindexderivat sker på Stockholmsbörsen även handel med s.k. warranter. Dessa liknar optioner, dvs. de ger innehavaren rättigheten, men inte skyldigheten, att köpa eller sälja en underliggande tillgång till ett bestämt pris innan eller vid en bestämd framtida tidpunkt. Utmärkande för warranter är att de i regel har betydligt längre tidshorisont än vanliga optioner – ibland flera år – och att de endast utfärdas av en part, oftast ett värdepappersinstitut. Vidare är en warrant överlåtbar. Därmed skiljer sig instrumentet från de icke-överlåtbara kontrakt som upprättas i form av standardiserade optioner på Stockholmsbörsen (som är central motpart i dessa affärer). Motpartsrisken torde därmed vara högre för warranter än för standardiserade optioner. Warranter handlas i betydande utsträckning även på Nordic Derivatives Exchange (NDX), som drivs av börsen Nordic Growth Market (NGM).

Utanför börserna sker handel med s.k. CFD-kontrakt (contract for differences) som enklast kan beskrivas som terminskontrakt utan

Prop. 2006/07:115

255

fastställd förfallodag. Kontrakten kan både köpas och säljas, vilket normalt sker med en förväntan om att det underliggande instrumentet skall stiga respektive falla i pris. Placeraren erlägger säkerhet (behovet av säkerheter uppdateras kontinuerligt) och betalar därtill en daglig räntekostnad så länge positionen förblir öppen. Vinst och förlust beror på utvecklingen av det underliggande instrumentet från tidpunkten för köp eller försäljning av det motsvarande CFD-kontraktet.

5.2 Handeln med räntebärande instrument

Handeln med räntebärande instrument avviker på många sätt från handeln med aktier, när det gäller såväl aktörer som motiv och handelssätt. Marknaden domineras av institutionella investerare, vilket bl.a. innebär transaktioner med stora belopp. Omsättningen mätt i kronor överstiger därför aktiemarknadens omsättning, trots att de räntebärande instrumentens sammanlagda marknadsvärde (2 325 miljarder kronor i september 2006) understiger börsvärdet.

Räntebärande instrument avviker från aktier bl.a. på det sättet att de ger en i förväg fastställd avkastning – en ränta. Marknaden för räntebärande instrument brukar ofta delas in i en obligationsmarknad och en penningmarknad. På obligationsmarknaden handlas värdepapper – obligationer – med längre löptider medan handeln på penningmarknaden omfattar t.ex. statsskuldväxlar och certifikat med kortare löptider, vanligen upp till ett år.

Många av obligations- och penningmarknadernas drag är gemensamma, med möjligt undantag för det allra kortaste löptidssegmentet. Aktörerna är i stort sett desamma (framför allt staten, bostadsinstitut och banker) och handelsstrukturen är likartad. Däremot kan handelns syfte skilja sig något i de två fallen. Förenklat kan man säga att obligationsmarknadens huvudsakliga uppgift är att förmedla långsiktigt sparande till aktörer som har behov av kapital, medan likviditetshantering är en framträdande uppgift för penningmarknaden. När det gäller penningmarknadens allra kortaste segment – med löptider från en dag upp till en vecka – sker bl.a. daglig utjämning av under- och överskott på marknadsaktörernas transaktionskonton.

5.2.1 Handeln på obligations- och penningmarknaderna

En obligation är ett löpande skuldebrev, vanligtvis bestående av en serie räntebetalningar (kuponger) och en slutbetalning. Obligationer ges ut av exempelvis staten, bostadsinstitut, kommuner eller företag och kan enkelt överlåtas mellan innehavare. På obligationsmarknaden sammanförs de aktörer som förvaltar långsiktigt sparande med privata och offentliga institutioner som är i behov av lånekapital. Dominerande låntagare på obligationsmarknaden är staten och bostadsinstituten.

Penningmarknaden är ett samlingsbegrepp för handeln med kortfristiga räntebärande tillgångar, löptiden understiger i regel ett år. En viktig uppgift för penningmarknaden är att underlätta likviditetshanteringen i ekonomin. Exempelvis behöver banker ha en beredskap för framtida in-

rop. 2006/07:115

256

P och utbetalningar. En betydande andel av aktiviteten på penningmarknaden är koncentrerad till de allra kortaste löptiderna upp till två dagar, där handeln baseras på särskilda typer av kontrakt.

Handelsstruktur

Marknaden för räntebärande instrument baseras till stor del på telefonhandel. Jämfört med aktiehandeln sker betydligt färre avslut på räntemarknaden, medan beloppen vanligtvis är avsevärt högre. Eftersom antalet affärer är relativt litet används i stor utsträckning marknadsgaranter, som ställer köp- och säljkurser både i handeln sinsemellan och i handeln med kunder. Handeln mellan marknadsgaranter brukar kallas ”interbankhandel”, medan övrig handel brukar kallas ”kundhandel”. All kundhandel, även sådan där varken slutlig köpare eller säljare är en marknadsgarant, sker med en marknadsgarant som motpart. Att marknadsgaranten går in som motpart och utför affären mot eget lager hänger samman med att de fåtaliga avsluten inte möjliggör orderdriven handel. En effektiv prisbildning upprätthålls genom att marknadsgaranterna hela tiden ställer s.k. tvåvägspriser (köp- och säljpriser) mot varandra, med en överenskommen marginal däremellan.

Det förekommer en viss utveckling mot en mer terminalbaserad handel genom en elektronisk plattform för interbankhandel i statsobligationer. För närvarande sker handeln på denna med tre så kallade benchmarkobligationer, vilka är de mest omsatta statsobligationerna med löptider om två, fem respektive tio år. Denna handel sker i Stockholmsbörsens elektroniska system SAXESS. Den elektroniska handeln i benchmarkobligationer är tillgänglig endast för marknadsgaranter.

Emittenter

De största emittenterna av räntebärande instrument är staten och bostadsinstituten. Statens upplåning genom Riksgäldskontoret motiveras av behovet att förvalta statsskulden. Bostadsinstituten emitterar obligationer och certifikat för att finansiera allmänhetens bostadslån. I september 2006 svarade statens samlade upplåning i statsobligationer och statsskuldväxlar för 42,5 procent av den utestående stocken av räntebärande instrument, medan bostadsinstituten svarade för 35,9 procent. Övriga låntagare svarade således för en mindre andel (21,6 procent) av den utestående stocken.

Bland övriga låntagare på marknaden för räntebärande instrument ingår icke-finansiella företag och banker som i september 2006 svarade för 9,5 respektive 7,1 procent av den utestående stocken av räntebärande instrument. Stora och välkända börsbolag kan även vända sig till internationella företagsobligationsmarknader i euro eller amerikanska dollar för att få tillgång till kapital, varför upplåningen i svenska kronor inte ger hela bilden. Kvarvarande låntagare på dessa marknader är övriga kreditmarknadsföretag, utöver bostadsinstitut och banker, samt kommuner som tillsammans svarade för cirka fem procent av den samlade upplåningen.

Prop. 2006/07:115

257

Placerare

Statistik om placerarna i räntebärande instrument publiceras med avsevärd fördröjning. Särskilt viktiga placerarkategorier är försäkringsbolag och utländska placerare som sammantaget höll närmare två tredjedelar av stocken (64,4 procent) vid utgången av 2005. Hushållen förekommer inte i statistiken på annat sätt än som restpost. Utländska placerare torde i praktiken domineras av utländska finansiella institutioner.

Utöver svenska försäkringsbolag och utländska placerare förekommer banker respektive restposten ”företag och övriga” bland de större placerarna med tillsammans närmare 30 procent av innehaven. Därtill kommer AP-fonderna som tidigare hade betydande innehav av svenska räntebärande instrument men som fick nya placeringsregler 2001 och därefter svarar för en mindre andel av de samlade innehaven (sex procent vid utgången av 2005).

Omsättning

Handeln med räntebärande instrument utmärks bl.a. av en hög omsättningshastighet. Omsättningen av statspapper är väsentligt högre än omsättningen av aktier. Under 2005 var denna omsättning 38 miljarder kronor per dag, varav drygt 28 miljarder kronor avsåg statsobligationer och resten statsskuldväxlar. Under samma år uppgick omsättningen av aktier på Stockholmsbörsen till 15 miljarder kronor per dag, medan omsättningen steg till 22 miljarder kr per dag under 2006. Omsättningen av samtliga räntebärande instrument översteg omsättningen av aktier än mer, trots att börsvärdet vid slutet av året (3 500 miljarder kronor 2005 och 4 275 miljarder kronor 2006) översteg den utestående stocken av räntebärande instrument (mindre än 2 300 miljarder kronor båda åren). En schablonmässig kalkyl baserad på förhållanden som var rådande 2005 visar att volymen av statspapper, både obligationer och statsskuldväxlar, omsattes cirka nio gånger under loppet av året, medan stocken av bostadsobligationer och bostadscertifikat omsattes mindre än fyra gånger respektive sex gånger under året.

Omsättningen tenderar att vara beloppsmässigt högre i handeln med obligationer eftersom de utestående volymerna är högre. Samtidigt är penningmarknadsinstrument kortfristiga, vilket leder till ett naturligt behov att omsätta förfallna instrument. Exempelvis hinner certifikat med ursprunglig löptid tre månader omsättas fyra gånger under loppet av ett år utan att det sker någon egentlig handel.

Vid sidan av den institutionella handeln med obligationer sker även viss obligationshandel i mindre skala på SOX, som är en del av Stockholmsbörsen. Här handlas exempelvis privatobligationer utgivna av bostadsinstitut och som främst är riktade till privatpersoner och andra mindre placerare. Omsättningen på SOX uppgick till drygt 4,7 miljarder kronor under 2005 (6,9 miljarder kronor t.o.m. november 2006).

Prop. 2006/07:115

258

Penningmarknadens kortaste del

När löptiderna på penningmarknaden går ner mot en vecka eller kortare blir vanliga värdepapper mindre praktiska. I stället används andra kontraktslösningar, som depositkontrakt och repor (repurchase agreements). Depositkontrakt kan liknas vid lån med standardiserade löptider, medan repor är lånetransaktioner mot säkerhet i värdepapper. Genom standardiserade kontraktslösningar behöver aktörerna endast komma överens om löptid, belopp och räntan på in- eller utlåningen.

Storbankerna uppskattar att cirka 90 procent av omsättningen i depositkontrakt avser löptider upp till två dagar. Merparten av depositinlåningen i kronor med löptiden en svensk bankdag sker mellan svenska kreditinstitut.

5.2.2 Handeln med derivatinstrument på räntemarknaden

På räntemarknaden handlas bl.a. ränteterminer, ränteswappar och ränteoptioner. De mest använda derivatinstrumenten på den svenska räntemarknaden benämns STIBOR Forward Rate Agreements (STIBOR FRA). Dessa räntederivat är standardiserade ränteterminer med depositkontrakt som underliggande instrument och med bestämda förfallodagar. Omsättningen i STIBOR FRA var i genomsnitt 32 miljarder kronor per dag under 2005.

Övriga terminskontrakt på den svenska räntemarknaden utgörs av obligationsterminer och statsskuldväxelterminer. Den genomsnittliga omsättningen i obligationsterminer med underliggande statsobligation var 15 miljarder kronor per dag under 2006. Omsättningen i obligationsterminer med bostadsobligationer som underliggande instrument var i genomsnitt drygt två miljarder per dag under 2006. Omsättningen i statsskuldväxelterminer var i genomsnitt 0,5 miljarder kronor per dag under 2006.

En annan typ av derivatinstrument på räntemarknaden är swappar. En ränteswapp innebär en överenskommelse mellan två aktörer om att under en bestämd tidsperiod utbyta ränteflöden. Exempelvis kan en aktör välja att betala en fast ränta i utbyte mot att erhålla rörliga räntebetalningar. Ett swappinstrument fungerar i praktiken som en portfölj bestående av terminskontrakt. Ränteswappar med lång löptid som används i Sverige benämns internationellt IRS (Interest Rate Swap) och innebär byten av ränteflöden under flera år. Ränteswappar med kortare löptid har benämningen STINA (Tomorrow/Next Day STIBOR Swap). Ett STINAkontrakt innebär en överenskommelse om att, under en löptid om högst ett år, betala eller erhålla skillnaden mellan en fast avtalad ränta och en över perioden variabel dagslåneränta. Tyvärr finns det ingen löpande statistik över omsättningen i ränteswappar tillgänglig.

En option på räntemarknaden utgörs av ett kontrakt med ett räntebärande instrument som underliggande tillgång. I Sverige handlas så kallade statsobligationsoptioner, där den underliggande finansiella tillgången utgörs av en statsobligation. Omsättningen i statsobligationsoptioner uppgick till i genomsnitt 0,4 miljarder kronor per dag under 2006.

Prop. 2006/07:115

259

Handelsstruktur

Derivatinstrument kan handlas antingen direkt mellan en köpare och en säljare, dvs. genom OTC-handel, eller via organiserade börser. På en börs är handeln i derivatinstrument standardiserad med kända förfallodagar och kontraktsstorlekar. Derivatinstrument som handlas OTC kan antingen vara standardiserade eller skräddarsydda utifrån köparens eller säljarens behov. Likviditeten är generellt sett bättre i de börshandlade derivaten. I Sverige handlas enbart OTC-derivat på räntemarknaden, oftast med standardiserade villkor. Clearingen av en del av dessa OTCderivat görs av Stockholmsbörsen som därmed går in som motpart mellan köpare och säljare. Den aktiva handeln i derivatinstrument sker på en marknad där ett antal marknadsgaranter fastställer priser per telefon eller elektroniskt.

5.3 Värdepappersinstituten

För att få driva värdepappersrörelse krävs Finansinspektionens tillstånd. Enligt lagen om värdepappersrörelse får tillstånd ges för:

1. handel med finansiella instrument för annans räkning i eget namn, 2. förmedling av kontakt mellan köpare och säljare av finansiella

instrument eller i annat fall medverkan vid transaktioner avseende sådana instrument, 3. handel med finansiella instrument för egen räkning, 4. förvaltning av någon annans finansiella instrument, och 5. garantigivning eller annan medverkan vid emissioner av

fondpapper eller erbjudanden om köp eller försäljning av finansiella instrument som är riktade till en öppen krets.

Värdepappersinstitut är ett samlingsbegrepp för värdepappersbolag och svenska kreditinstitut, dvs. banker och kreditmarknadsföretag, som har Finansinspektionens tillstånd att driva värdepappersrörelse samt utländska företag som driver värdepappersrörelse från filial här i landet. I slutet av 2006 hade cirka 225 svenska företag Finansinspektionens tillstånd att bedriva värdepappersrörelse i någon form. Drygt hälften av dessa var värdepappersbolag, medan de övriga huvudsakligen var banker samt fondbolag med tillstånd att förvalta någon annans finansiella instrument, s.k. diskretionär förvaltning.

Möjligheten för kreditmarknadsföretag att ansöka om tillstånd att driva värdepappersrörelse öppnades i samband med införandet av lagen (2004:297) om bank- och finansieringsrörelse. I december 2006 hade emellertid inget svenskt kreditmarknadsföretag utnyttjat denna möjlighet.

Även införandet av lagen (2004:46) om investeringsfonder innebar en viss utvidgning av möjligheten att bedriva värdepappersrörelse. Genom lagen fick fondbolag möjlighet att söka tillstånd att bedriva diskretionär förvaltning. I december 2006 hade ett femtontal svenska fondbolag utnyttjat denna möjlighet.

Prop. 2006/07:115

260

Svenska värdepappersbolag

Av de 117 värdepappersbolag som var registrerade i slutet av 2006 var elva s.k. fullsortimentbolag, dvs. med tillstånd för samtliga ovan angivna investeringstjänster. Dessa bolag är i regel också medlemmar på Stockholmsbörsen. I gruppen av fullsortimentbolag märks kända värdepappersbolag som Alfred Berg, Enskilda Securities, E. Öhman J:or, Erik Penser, Fischer Partners och Hagströmer & Qviberg m.fl.

De värdepappersbolag som inte innehar samtliga tillstånd kan vara specialiserade på någon eller några verksamheter för vilka det räcker med ett eller ett par tillstånd. I den gruppen återfinns exempelvis ett stort antal mindre kapitalförvaltningsbolag, men även andra inriktningar förekommer. I gruppen av värdepappersbolag som inte innehar samtliga tillstånd var sju medlemmar på Stockholmsbörsen.

Bland värdepappersbolagen återfinns även 14 kraft- och råvarubolag. Dessa innehar visserligen ofta ett flertal tillstånd, men de skiljer sig från de övriga bolagen genom att vända sig till professionella kunder och inte agera på detaljistmarknaden.

Svenska kreditinstitut

Utöver värdepappersbolagen driver även många banker omfattande värdepappersverksamhet. Av de totalt 31 bankaktiebolag som var inregistrerade i Sverige i slutet av 2006 hade 28 tillstånd att driva värdepappersrörelse. Fjorton av dessa var börsmedlemmar, varav elva innehade ett fullt sortiment av värdepappersrörelsetillstånd. Här återfinns exempelvis de fyra storbankerna Swedbank, Handelsbanken, Nordea och SEB.

Här återfinns även en kategori företag som i grunden endast driver värdepappersrörelse, men som av olika skäl ansökt om och fått banktillstånd. I denna kategori återfinns t.ex. Carnegie Investment Bank, EFG Investment Bank, Kaupthing Bank Sverige och Nordnet Securities Bank. Därutöver har svenska värdepappersbolag en möjlighet att ansöka om att med vissa begränsningar få ta emot inlåning på konto, vilket är ett svenskt särdrag.

Förutom ovan nämnda värdepappersbolag och bankaktiebolag hade 66 sparbanker något eller några värdepappersrörelsetillstånd i slutet av 2006. Vanligen rör det sig som om tillstånd att förmedla värdepappersaffärer, dvs. att ta emot en kunds order lokalt och förmedla den till någon anknuten fullsortimentbank. Sparbanken Finn innehar dock fullt sortiment av värdepappersrörelsetillstånd och är dessutom medlem på Stockholmsbörsen (Sparbanken Gripen, som har motsvarande tillstånd, ingår bland bankaktiebolagen).

Utländska värdepappersföretag och banker med verksamhet i Sverige

Ett stort antal utländska företag bedriver gränsöverskridande värdepappersverksamhet i Sverige med stöd av tillstånd givna av hemlandets myndigheter och efter notifiering till Finansinspektionen. I november 2006 var 1 178 utländska värdepappersföretag notifierade för gränsöverskridande handel i Sverige, varav 17 var fjärrmedlemmar på

Prop. 2006/07:115

261

Stockholmsbörsen. Bland dessa företag märks bl.a. några av de större internationella värdepappersföretagen, som JP Morgan Securities, Lehman Brothers International (Europe) UK, Merrill Lynch International och Morgan Stanley & Co International. I gruppen finns även ett antal nordiska värdepappersföretag, som tillika är fjärrmedlemmar på Stockholmsbörsen. Dit hör exempelvis Christiania Securities (Norge) och FIM Securities (Finland).

Antalet utländska banker som var registrerade för gränsöverskridande verksamhet i Sverige var 296 i december 2006, bland vilka ingick ytterligare 17 fjärrmedlemmar på Stockholmsbörsen. Av dessa känns några igen som större europeiska banker. Hit hör exempelvis ABN AMRO Bank NV London Branch, Commerzbank AG, Credit Suisse Securities (Europe) Ltd, Deutsche Bank AG samt HSBC Bank Plc. Därutöver återfinns även ett antal nordiska banker, som bedriver handel på Stockholmsbörsen med utgångspunkt från fjärrmedlemskap från sina hemländer. Hit hör Danske Bank och Jyske Bank (Danmark), eQ Bank och Evli Bank (Finland) samt Landsbanki Íslands (Island).

Det finns även utländska företag som bedriver värdepappersrörelse från filial i Sverige. I november 2006 hade 15 utländska värdepappersbolag svensk filial. Några av dessa företag deltar i handeln på Stockholmsbörsen, men då inte i första hand via den svenska filialen, utan med utgångspunkt från de fjärrmedlemskap på börsen som företagen har i sina Londonbaserade verksamheter. Till denna kategori hör Citigroup Global Markets Ltd UK, Goldman Sachs International och Lehman Brothers International (Europe).

I november 2006 fanns det 26 utländska banker med filial i Sverige. Av dessa är några renodlade banker som inte bedriver någon värdepappersrörelse i Sverige eller som gör det endast i begränsad omfattning. Men det finns även sådana som har en tämligen omfattande värdepappershandel. I likhet med värdepappersföretagen sker dessa bankers handel vanligen med utgångspunkt från fjärrmedlemskap från koncernens hemlands- eller Londonbaserade enheter. Till denna senare kategori hör Danske Bank, Deutsche Bank, Evli Bank och UBS Limited.

5.4 Den finansiella elmarknaden

Sedan elmarknaden avreglerades i Sverige 1996 har marknaden för fysisk el kommit att kompletteras med en finansiell elmarknad. Den finansiella elmarknaden omfattar handel med elderivat, dvs. derivatkontrakt som har el som underliggande tillgång. Sådana kontrakt är ett verktyg för företag som köper och säljer el att prissäkra sina kontrakt och på så sätt minska sina affärsrisker. Derivathandeln möjliggör också spekulation i förändringar av elpriser. Såväl den finansiella som den fysiska elmarknaden är i hög grad integrerad mellan de nordiska länderna (utom Island).

Handeln på Nord Pool

Handeln med elderivat sker på den nordiska marknadsplatsen Nord Pool, som även fungerar som marknadsplats för fysisk el i Norden. Handeln

Prop. 2006/07:115

262

med fysisk el sker på spotmarknaden och handeln med derivatkontrakt med el som underliggande vara sker på den finansiella elmarknaden. På Nord Pool handlas även elcertifikat och utsläppsrätter, som är miljöpolitiska instrument för att främja produktionen av förnyelsebara energikällor, respektive minska utsläppen av växthusgaser.

Nord Pool är belägen i Oslo och har tillstånd som fullvärdig börs enligt norsk börslagstiftning. Nord Pool ägs till hälften var av Affärsverket Svenska Kraftnät och Statnett SF i Norge och har, förutom huvudkontoret i Oslo, även kontor i Stockholm, Fredericia på Jylland samt Helsingfors.

Utgångspunkten för den finansiella elmarknaden är den fysiska elmarknaden. Kraftpriset sätts per timme på Nord Pools spotmarknad. Producenter och konsumenter lägger in sälj- och köpbud för kommande dygn och priset sätts där utbud möter efterfrågan. Därmed får man ett s.k. systempris vilket fungerar som referenspris för den övriga elmarknaden. Sedan 2006 prissätts de kontrakt som handlas på Nord Pool i euro.

Aktörerna på Nord Pool är kraftproducenter, distributörer, industriföretag, mäklare och handlare. I november 2006 hade den finansiella elmarknaden 121 medlemmar, varav 27 utanför de nordiska länderna. En förutsättning för börsmedlemskap på Nord Pool är att man är accepterad av Nord Pool Clearing som clearingmedlem.

Alla svenska företag med Finansinspektionens tillstånd att bedriva värdepappersrörelse har i princip rätt att agera på den finansiella elmarknaden. Marknaden domineras emellertid av aktörer med nära koppling till företag som producerar eller handlar med el. I december 2006 var 19 svenska bolag aktiva som medlemmar på den finansiella elmarknaden.

De elderivat som handlas på den finansiella elmarknaden är terminer, optioner och ett speciellt kontrakt benämnt Contracts for Difference. Ett terminskontrakt i el innebär ett åtagande att köpa eller sälja el till ett bestämt pris vid en viss framtida tidpunkt. Terminskontrakt kan vara standardiserade ”futures” eller skräddarsydda OTC-kontrakt, ”forwards”. På Nord Pool handlas futures med löptider på normalt ett par veckor och forwards med löptider upp till fyra år.

Contracts for Difference är ett forwardkontrakt som gör det möjligt för aktörer att gardera sig mot prisskillnader på el som uppstår mellan olika länder i Norden till följd av begränsningar i överföringskapaciteten mellan olika områden (syftet är att kompensera för eventuella prisskillnader mellan elderivat och det lokala elpriset, s.k. basis risk). Observera att begreppet Contracts for Difference därmed har getts en specifik och avvikande betydelse jämfört med likalydande kontrakt (Contract for Differences) som har finansiella instrument som underliggande tillgång (avsnitt 5.1.6).

Genom eloptioner kan aktörerna säkra sig mot oförmånliga prisrörelser. De optioner som handlas på Nord Pool är av ”europeisk” typ, dvs. de kan lösas först på lösendagen. På Nord Pool är optionens underliggande tillgång ett forwardkontrakt. Avvecklingen av samtliga affärer i elderivat på Nord Pool sker genom kontantavräkning, dvs. utan fysisk leverans av el.

Prop. 2006/07:115

263

Handel utanför Nord Pool

Vid sidan av handeln på Nord Pool omsätts kontrakt på OTC-marknaden. Denna marknad är mäklardriven och sker via telefon eller vid elektroniska marknadsplatser. Vid sidan om OTC-handeln förekommer även bilateral handel mellan marknadens aktörer, dvs. utanför värdepappersmarknaden. Att handla utanför Nord Pool medför ofta att transaktionskostnaderna blir lägre. Aktörerna tar emellertid en motpartsrisk, något som dock kan elimineras om affären avvecklas genom Nord Pool. Skälen till att genomföra handel utanför Nord Pool kan vara många, men Nord Pools avgift är sannolikt ett av skälen. Dessutom är möjligheten att handla utanför Nord Pool en fördel för aktörer som inte vill visa sina handelsvolymer.

Prop. 2006/07:115

264

6 Principer för finansiell reglering

Regleringen av handeln med finansiella instrument går i många fall längre än vad som gäller för näringsverksamhet i andra sammanhang, t.ex. när det gäller behovet av tillstånd för att bedriva verksamhet, regler för hantering och utförande av kundorder eller krav på uppföljning genom Finansinspektionens tillsyn. Bakom den omfattande regleringen finns underliggande motiv som har samband med den finansiella sektorns samhällsekonomiska betydelse. I det följande berörs kortfattat den finansiella sektorns funktioner och motiven för reglering av handeln på de finansiella marknaderna i två separata avsnitt (6.2 och 6.3). En förståelse av grunderna för, och syftet med, det finansiella regelverket har betydelse bl.a. vid tolkningar och avvägningar i samband med tillämpningen av det nya regelverket (se avsnitt 5 i utredningens betänkande SOU 2006:50 för en utförligare diskussion). När det gäller MiFID har frågor som rör fragmentering, internalisering och genomlysning särskilt intresse. Dessa frågor uppmärksammas därför separat (6.4). Avslutningsvis görs en sammanfattande bedömning (6.5).

6.1 Den finansiella sektorns funktioner

6.1.1 Grundläggande funktioner

Den finansiella sektorn brukar sägas fylla tre grundläggande huvuduppgifter i ekonomin: kapitalförmedling, riskhantering och betalningsförmedling. Dessa funktioner fullgörs på de finansiella marknaderna och genom de finansiella företag som verkar i anslutning till dessa marknader.

Behovet av kapitalförmedling uppstår som en konsekvens av att sparande och investeringsbehov i allmänhet är ojämnt fördelade över tid och rum. Hushållssektorn har exempelvis ett behov av att omfördela sparande över livscykeln. Det kan handla om att låna till investeringar i bostad och utbildning i unga år eller att spara till pension och konsumtion på äldre dagar. Grovt sett har hushållssektorn har ett överskott av sparande, medan de största kapitalbehoven i allmänhet avser företag med investeringsbehov. Genom placering av sparmedel på de finansiella marknaderna – direkt genom köp av finansiella instrument eller indirekt genom t.ex. banksparande eller försäkringssparande – kan hushållen göra medlen tillgängliga för de finansiella marknaderna och, i förlängningen, företag med kapitalbehov. Den kapitalförmedlande funktionen förutsätter att den finansiella sektorn förmår prissätta och förmedla de risker som ofrånkomligen följer av att företag med kapitalbehov har olika kreditvärdighet.

Marknadens förmåga att hantera risker är även värdefull i sig, t.ex. genom försäkringar eller handel med finansiella derivat. Privatpersoner kan exempelvis försäkra sig mot villabrand eller stöld. Ett skogsföretag kan eliminera den valutarisk som kan förknippas med förväntade försäljningsintäkter genom att ingå ett terminskontrakt som fastställer den kurs till vilken kommande intäkter i utländsk valuta skall växlas till

Prop. 2006/07:115

265

kronor. På detta sätt överlåts risken för brand eller stöld, respektive risken för att den utländska valutan skall falla i pris, till någon annan.

Vid sidan av att förmedla kapital och hantera risker tillhandahåller den finansiella sektorn betalningstjänster genom banksystemet. Kontanta medel, betalkort, kreditkort och kontoöverföringar gör att varor och tjänster kan utbytas på ett smidigt och ekonomiskt effektivt sätt. Det finns också en stark koppling mellan värdepappersmarknaderna och betalningsväsendet, eftersom de stora betalningsflöden som genereras i handeln med finansiella instrument svarar för en betydande del av det samlade flödet av betalningar i nätverket mellan banker, clearingorganisationer och centralbanker som sammantaget utgör betalningsväsendet.

6.1.2 Finansiella marknader och värdepappersinstitut

På de finansiella marknaderna sker handeln med finansiella instrument genom vilka kapital och risker överförs från finansiärer till mottagare, respektive mellan parter som har olika benägenhet eller förmåga att bära risk. Tillskapandet av finansiella instrument underlättar kapitalförmedlingen genom att stora kapitalbehov och finansiella risker fördelas på mindre poster som i sin tur kan överlåtas till andra aktörer genom handeln på marknaden.

Handeln på de finansiella marknaderna underlättar kapitalförsörjningen genom att överbrygga skillnader mellan finansiärer och mottagande företag när det gäller kapitalbehovens storlek, varaktighet och risk. Kravet på avkastning för att binda kapital i finansiella instrument minskar när det finns likvida marknader som gör det möjligt att överlåta innehaven till andra aktörer. Utbudet av finansiella instrument på marknaden möjliggör även riskspridning som i sin tur reducerar finansiärernas risk och bidrar till att sänka företagens kapitalkostnad ytterligare.

Genom marknadens prissättning får allmänheten information om kostnaden för kapitalanskaffning. Handeln med derivat som har finansiella instrument som underliggande tillgång ger specifik information om prissättning av finansiella risker. Marknadens prissättning innehåller information om kapitalkostnader som kan läggas till grund för investeringsbeslut. Det är ett samhällsintresse att denna prissättning fungerar väl så att investeringsbeslut fattas på rätt grunder.

Ett värdepappersinstitut uppträder ofta som mellanhand vid köp och försäljning av finansiella instrument, antingen genom att förmedla affären till marknaden eller genom att själv inträda som motpart. Värdepappersinstitut kan även förvalta medel för sina kunders räkning, lämna investeringsråd eller uppträda som rådgivare i samband med företagsförvärv eller kapitalanskaffning. Även andra tjänster är möjliga, såsom drift av MTF:er.

Prop. 2006/07:115

266

6.2 Motiv för reglering

6.2.1 Inledning

Det uppstår ett behov av reglering om marknadsmekanismen fungerar mindre väl, dvs. om det finns s.k. marknadsimperfektioner eller marknadsmisslyckanden som introducerar någon typ av hinder för att aktörerna på egen hand skall fatta beslut som är förenliga med övergripande samhällsekonomiska mål. Exempel på marknadsmisslyckanden som är relevanta i sammanhanget är externa effekter, ofullständig konkurrens och informationsproblem som i sin tur kan sammanhänga med olika typer av intressekonflikter.

Negativa externa effekter föreligger när beslut fattade av enskilda aktörer medför kostnader för andra, utan att den aktör som fattar beslutet har motiv att ta hänsyn till dessa. Utbudet av vissa produkter eller tjänster riskerar därmed att bli större än de samlade kostnaderna motiverar. Det klassiska exemplet på marknadsmisslyckande till följd av negativa externa effekter är när en fabrik, samtidigt som den producerar varor, även producerar luftföroreningar som drabbar omgivningen. Det uppstår med andra ord en samhällsekonomisk kostnad som fabrikanten i det här fallet inte tagit hänsyn till, vilket utgör motiv för samhället att gripa in med reglering av miljöstörande produktion.

Ofullständig konkurrens kan leda till högre priser jämfört med en situation när konkurrensen är god. Även produktutveckling och konsumentnytta kan bli lidande. En orsak till ofullständig konkurrens kan vara stordriftsfördelar som innebär svårigheter för mindre aktörer att etablera sig genom en naturlig koncentrationstendens som ger de redan existerande företagen en konkurrensfördel.

Informationsproblem och intressekonflikter hänger samman med aktörernas olika tillgång till information, vilket brukar beskrivas som att informationen är asymmetriskt fördelad. Konsumenter av finansiella tjänster har ofta ett betydande informationsunderläge gentemot leverantörerna av dessa tjänster. Finansiella produkter och tjänster är ofta komplexa och kan innehålla risker som är svåra att förstå. Även när det gäller professionella aktörer kan förekomsten av asymmetriskt fördelad information ge upphov till svårbemästrade intressekonflikter, vilket kan rubba förtroendet för berörda institut. Om förtroendet för värdepappersinstituten försämras, kan detta få negativa återverkningar på marknadens funktion.

Värdet av regleringar som syftar till att kompensera imperfekta marknader eller marknadsmisslyckanden måste slutligen vägas mot de kostnader som regleringarna medför. Praktiska svårigheter att mäta nytta och kostnader innebär att avvägningen ofta blir kvalitativ, snarare än kvantitativ (se avsnitt 18).

6.2.2 Behovet av systemskydd

Det tydligaste motivet för reglering av finansiella företag är systemskyddsintresset. Detta hänger samman med förhållandet att vissa verksamheter i den finansiella sektorn är förknippade med betydande systemrisk, dvs. risken för att det ska uppstå en allvarligare störning i

rop. 2006/07:115

267

P någon del av finansiella systemet som med ett eventuellt självförstärkande krisförlopp fortplantar sig till övriga delar av systemet. En sådan systemkris, som i förlängningen leder till ett sammanbrott i någon av det finansiella systemets vitala funktioner, kan vara ytterst kostsam för samhället och ge upphov till betydande och långvariga återverkningar i resten av ekonomin. Farhågor för sådana systemkriser är mycket speciella för den finansiella sektorn och har få direkta motsvarigheter inom andra samhällsområden. Detta hänger samman med två förhållanden; dels att vissa funktioner i det finansiella systemet är särskilt känsliga för störningar och har inneboende tendenser till smittoeffekter, dvs. att störningar som uppstår i ett institut lätt fortplantar sig till andra institut, dels att smittoeffekterna skapar kostnader för samhället som privata aktörer inte har anledning att beakta när de fattar sina beslut. Det föreligger med andra ord negativa externa effekter.

De mest bekymmersamma – och mest välanalyserade – systemriskerna finns i banksektorn, och berör framför allt de största bankernas roll i betalningssystemet. Det klassiska exemplet på systemrisk är när finansiella problem i en bank leder till en uttagsanstormning (”bank run”) som i sin tur underminerar förtroendet för hela banksystemet. På ett dominoliknande sätt kan problem (eller enbart misstanken om problem), som ursprungligen berör endast en bank, leda till att hela banksystemet råkar i svårigheter, varvid framför allt betalningsförmedlingsfunktionen, men till viss del även kapitalförmedlingsfunktionen i ekonomin, riskerar kollaps. Se exempelvis Banklagskommitténs betänkande (SOU 1998:160) för en utförlig redogörelse för systemrisker i banksektorn.

De systemrisker som är förknippade med värdepappershandeln är sannolikt något mindre allvarliga än de som finns i traditionell bankverksamhet, men riskerna ökar i betydelse i takt med att värdepappersmarknaderna spelar en allt större roll i samhällsekonomin. Systemriskerna på värdepappersmarknaderna härrör dels från marknadernas betydelse för clearing- och avvecklingsfunktionerna, dels från bankernas behov av likviditet på värdepappersmarknaderna. Bankerna är i växande grad beroende av marknaderna, både för sin finansiering och för sin riskhantering. Det finns alltså en koppling mellan systemriskerna i värdepappershandeln och de systemrisker i banksektorn som berördes ovan.

Till det kommer att värdepappershandeln är förknippad med en speciell form av externa effekter, s.k. nätverkseffekter (network externalities). I takt med att fler aktörer får tillgång till en viss marknad eller ett visst handelssystem, ökar nyttan för alla som deltar på marknaden eller i handelssystemet. Nätverket blir mer värdefullt, ju fler som deltar, genom att likviditeten blir bättre och effektiviteten större. Myntet har dock en baksida. Om likviditeten av någon anledning sjunker i någon del av marknaden, finns det en risk att likviditeten mycket snabbt dras undan från marknaden som helhet. Det finns alltså en risk för smittoeffekter i handeln med finansiella instrument. Detta var i stort vad som hände vid börskraschen 1987, i samband med krisen för hedgefonden LTCM 1998 och vid terrorattacken i september 2001. Det innebär att det måste finns en beredskap för tillfälliga störningar i handeln med finansiella instrument.

Prop. 2006/07:115

268

6.2.3 Behovet av konsumentskydd

Behovet av konsumentskydd på det finansiella området brukar härledas ur huvudsakligen två förhållanden, dels de finansiella tjänsternas stora betydelse för hushållens ekonomi, dels förekomsten av olika informationsproblem och därmed förknippade intressekonflikter. Konsumenter har ofta ett betydande informationsunderläge gentemot de företag som tillhandahåller finansiella tjänster. Vidare är finansiella tjänster och produkter ofta komplexa och kan innehålla risker som är svåra att förstå. Om investerare inte känner sig trygga i förvissningen om ett rimligt kundskydd, finns det en risk för att de avstår från att köpa finansiella tjänster i en utsträckning som är motiverad. Det skulle kunna innebära att hushållen sparar för litet eller bär onödiga finansiella risker.

Att finansiella tjänster, inte minst de tjänster som tillhandahålls via värdepappersmarknaderna, har kommit att spela en allt mer betydande roll i hushållens ekonomi hänger bl.a. samman med den demografiska utvecklingen och behovet av kompletterande privat pensionssparande, men också med ett ökat utbud av sparformer som tjänar som alternativ till traditionellt banksparande. Den andel av befolkningen som är 65 år eller äldre väntas stiga från drygt 17 procent vid utgången av 2006 till 23 procent 2035, enligt SCB:s prognoser. Sparandet i ekonomin behöver därför anpassas för att klara försörjningen av en växande andel pensionärer. Utvecklingen har hittills inneburit ett stort inflöde av kapital till värdepappersmarknaderna. Hushållen har därmed blivit allt mer beroende av utvecklingen på marknaderna. I samband med pensionssparande är det särskilt problematiskt att resultatet av sparandet blir känt med full säkerhet först långt in i framtiden, då det kan vara för sent att åtgärda eventuella misstag genom att byta sparstrategi.

Intressekonflikter uppstår framför allt som en konsekvens av att vissa värdepappersinstitut är verksamma på flera områden samtidigt. Ett tydligt exempel på intressekonflikt uppstår när ett institut agerar rådgivare samtidigt som det saluför egna finansiella produkter. Frestelsen att i rådgivningen främja de egna produkterna kan vara påtaglig. En variant av detta kan förekomma om försäljningsprovisioner eller liknande skapar incitament att marknadsföra vissa företags produkter, trots att det kan finnas andra produkter på marknaden som är mer fördelaktiga för kunden. En klassisk intressekonflikt uppstår mellan rollen som anskaffare av kapital åt företag, dvs. grossistkunder, och rollen att tillhandahålla lämpliga investeringar åt detaljistkunder. Eftersom huvuddelen av sådana finansiella företags intäkter ofta kommer från kapitalanskaffningsverksamheten kan intressekonflikten leda till att mindre kunder missgynnas. Det finns därutöver en rad inneboende konflikter i analytikerrollen.

Ett medel för att förbättra konsumentskyddet kan vara att förbättra genomlysningen – transparensen – i handeln med värdepapper och för relaterade tjänster. God genomlysning gynnar i allmänhet mindre kunder. Transparens i övermått kan dock vara mindre förmånligt för professionella aktörer, som inte alltid vill avslöja sina affärsintressen i förväg. Givet att de professionella aktörerna har större betydelse för värdepappersmarknadernas funktion kan ett överdrivet konsumentskydd försämra effektiviteten, vilket i slutändan även drabbar konsumenterna.

Prop. 2006/07:115

269

6.2.4 Behovet av effektivitet

När det gäller finansiella marknader talar man om önskvärdheten av effektivitet och integritet. För arbetet inom EU gäller ett sådant mål (se t.ex. skäl 71 i MiFID). Med marknadernas effektivitet menas aktörernas möjlighet att genomföra önskade transaktioner till låg kostnad medan marknadernas integritet syftar på graden av förtroende för marknadens funktion. En hög grad av integritet förutsätter att aktörernas order hanteras på ett rättvist sätt och att priserna uppfattas vara rättvisande och avspegla all tillgänglig information. Effektivitet och integritet är emellertid nödvändiga förutsättningar för att en marknad skall kunna konkurrera om orderflödet. Finansiella företag som driver olika typer av marknadsplatser har således skäl att av eget intresse ta hänsyn till mål som dessa. Kraven på effektivitet och integritet utgör därför inte tillräckliga motiv för att överväga reglering.

Effektivitet i denna mening avser möjligheten att genomföra transaktioner till låg kostnad, vilket bl.a. har samband med marknadens likviditet. Om en marknadsplats utmärks av hög likviditet är det troligt att många vill handla där, eftersom man då har goda förutsättningar att handla till de mest rättvisande priserna. De s.k. nätverkseffekter som utmärker handeln med finansiella instrument ger upphov till betydande naturliga koncentrationstendenser.

En annan aspekt av effektivitet rör s.k. systemeffektivitet. Denna hänger i stor utsträckning samman med möjligheterna att utnyttja stordriftsfördelar. Internationaliseringen av kapitalmarknaderna och harmoniseringen av lagar och regler inom EU har lett till ett ökat tryck på börser, clearingorganisationer och centrala värdepappersförvarare att konsolidera verksamheterna över nationsgränserna. I många fall har det tidigare funnits legala barriärer som motverkat en internationell konsolidering. När barriärer tas bort ökar konkurrenstrycket på de existerande nationella infrastrukturföretagen. Samtidigt förstärks incitamenten till samarbete och sammanslagning, exempelvis mellan börser och clearingorganisationer i olika länder. Det finns med andra ord tendenser till s.k. horisontell integration. Denna horisontella integration är ett sätt att nå större effektivitet genom att utnyttja stordriftsfördelar.

Som vi har funnit ovan skapar önskemålen om likviditet i handeln och systemeffektivitet tendenser till centralisering och konsolidering av handeln med finansiella instrument. Det hänger samman med de nätverkseffekter och stordriftsfördelar som är förknippade med värdepappershandeln. Dessa koncentrationstendenser kan emellertid uppstå på bekostnad av effektivitet i en mer dynamisk mening. Med ökad konsolidering och centralisering ökar risken för monopoltendenser. Dessa inbegriper bl.a. inträdeshinder för nya aktörer och svårigheter att etablera konkurrerande handelssystem. Det kan på sikt leda till monopolprissättning. Därmed är det inte säkert att de rationaliseringsvinster som uppnås genom horisontell integration kommer slutkunderna till del. För att uppnå dynamisk effektivitet är det viktigt att det förekommer konkurrens när det gäller olika sätt att tillhandahålla handel med finansiella instrument. Det är också viktigt att den reglering som styr dessa verksamheter inte blir så rigid och detaljerad att den hämmar fortsatt utveckling. Regelverket bör vara så

Prop. 2006/07:115

270

flexibelt att innovationer inte försvåras och att utrymme lämnas för nya sätt att organisera handeln med finansiella instrument, nya finansiella produkter och nya aktörer på marknaden.

6.3 Principiella överväganden i anslutning till MiFID

6.3.1 Fragmentering

Som nyss berörts utmärks värdepappersmarknader av en naturlig tendens till konsolidering. Trycket kommer både från utbudssidan, genom incitamenten att utnyttja stordriftsfördelar, och från efterfrågesidan genom de nätverkseffekter som är förknippade med likviditet. Samtidigt som detta sker inleds genom MiFID handel genom nya och konkurrerande handelssystem, vilket leder till en fragmentering av marknaderna.

Fragmentering stimulerar konkurrens, vilket bidrar till effektivitet i dynamisk mening, medan konsolidering kan bidra till minskade transaktionskostnader och eventuellt bättre likviditet. Överfört till MiFID-sammanhang kan man säga att systematiska internhandlare och MTF:er bidrar till fragmentering av värdepappersmarknaderna men också till förbättrad konkurrens.

Konkurrens förutsätter utbud från flera leverantörer. I fråga om värdepappersmarknaderna uppträder fragmentering när alla order som rör ett visst värdepapper inte möts inom ramen för en och samma handelsmekanism. Det som försvårar en sammanvägd analys av fragmentering är att konkurrens mellan order fungerar bäst på en konsoliderad marknad där alla order möts, medan konkurrens mellan olika marknadsplatser, som börser, handelssystem och OTC-handel – och alla de fördelar som sådan konkurrens medför – implicerar fragmenterade marknader. Konkurrens på de olika nivåerna förefaller alltså inte vara helt kompatibla med varandra.

Fördelen med konkurrens är att den bidrar till att hålla nere priserna på de tjänster som börser och andra handelssystem erbjuder. Konkurrens skapar också incitament till innovationer och rationaliseringar, exempelvis genom automatisering av handelssystemen eller genom nya möjligheter till handel med olika slags tillgångar.

Säljare av värdepapper söker i varje enskilt fall det högsta priset och köpare går dit där de tror sig kunna få lägst pris. Det innebär att de sannolikt kommer att mötas där skillnaden mellan köp- och säljkurs är minst, dvs. där likviditeten är bäst. Orderflöden attraherar alltså orderflöden, vilket innebär att handel i ett visst instrument sannolikt kommer att koncentreras till en enskild handelsmekanism, eller åtminstone till ett fåtal konkurrerande system. Samexistens mellan olika handelssystem kan vara optimalt om handlare har olika behov och önskemål, och om varje handelssystem uppfyller en viss investerarkategoris preferenser.

Prop. 2006/07:115

271

6.3.2 Internalisering

Med internalisering avses värdepappersinstitutens matchning och utförande av order mot egna handelsintressen snarare än mot börsens orderböcker, vilket är en form av fragmentering. Det har hävdats att internalisering skulle kunna vara skadlig för prisbildningsprocessen, i den mån likviditeten på börsen påverkas negativt, med sämre effektivitet i form av ökade marginaler mellan köp- och säljkurser och större prisrörelser (högre volatilitet) som resultat. För det andra skulle internalisering kunna leda till att för värdepappersinstituten särskilt attraktiva order (som utsätter instituten för låg risk) styrs bort från den primära handelsplatsen, medan mindre attraktiva order (som innebär högre risk) blir kvar. Detta skulle i sin tur kunna leda till att likviditeten på den öppna marknaden påverkas negativt.

Mot detta kan anföras att internalisering utsätter den primära eller centrala marknadsplatsen för konkurrens av alternativa handelsmekanismer, vilket i sig kan förväntas påverka effektiviteten positivt. För det andra får marknadsdeltagarna större valmöjligheter i fråga om var de vill utföra sina order, jämfört med att enbart ha en enda marknadsplats att vända sig till. För vissa kategorier av investerare har denna valfrihet ett värde.

En speciell form av internalisering avser mäklade affärer utanför börsen, vilket med en amerikansk term kan benämnas ”the upstairs market”. På denna marknad söker mäklare aktivt efter relevanta affärsintressen utanför börsen, framför allt när det gäller institutionella kundorder som är stora i förhållande till de köp- och säljintressen som är rådande på den öppna marknaden. Fördelen med ett sådant alternativ är att mäklarna kan utföra stora transaktioner utan att fullt ut exponera den bakomliggande ordern för resten av marknaden. De institutionella kunderna löper därigenom mindre risk för att marknadspriset skall röra sig i en oförmånlig riktning innan transaktionen blivit genomförd. Det innebär i sin tur bättre förutsättningar för utförandet av stora order och bättre likviditet.

6.3.3 Genomlysning

God genomlysning av en marknad för finansiella instrument kännetecknas av att investerarna ges tillräcklig information om köp- och säljintressen före handel (pre-trade transparency) och om redan avslutade affärer (post-trade transparency). God genomlysning bidrar till väl fungerande prisbildningsprocesser och möjliggör konkurrens mellan marknadsplatser. Genomlysning är också en förutsättning för bästa orderutförande. Det betyder däremot inte att mer genomlysning alltid är bättre.

Vilken grad av genomlysning som är lämplig kan skilja sig avsevärt mellan olika marknader, finansiella instrument och aktörer, vilket kan belysas med ett exempel. Om en aktieinvesterare, som är intresserad av att köpa en stor post aktier i ett visst företag, tvingas avslöja sina avsikter innan köpet genomförs riskerar detta offentliggörande att pressa upp priset eftersom andra investerare kan tro att köparen har ny positiv information om företaget som inte är allmänt känd. Detta kommer att

Prop. 2006/07:115

272

minska förtjänsten av att förvärva aktierna, vilket kan leda till att investeraren väljer att avstå från att handla eller väljer en annan marknadsplats. I grunden uppstår problemet eftersom handeln i sig skapar information som är värdefull för andra investerare.

Att hitta en lämplig nivå för genomlysning innebär ett antal avvägningar. Det gäller att uppnå en tillräckligt hög grad av genomlysning för att locka till sig investerare, men samtidigt en genomlysning som inte är så stark att investerarnas möjligheter att genomföra stora transaktioner minskar alltför mycket. Generellt torde små investerare gynnas av en högre grad av genomlysning, i vart fall så länge detta inte påverkar marknadseffektiviteten negativt, medan större och för marknadens funktion viktigare aktörer kan gynnas av en något lägre grad av genomlysning. Den lämpliga nivån för genomlysningen innebär därför en avvägning mellan olika investerares intressen.

Aktiemarknaderna – där mindre investerare ofta deltar – kännetecknas vanligen av en högre grad av genomlysning än exempelvis ränte- och valutamarknaderna, där i första hand professionella aktörer deltar. Över tiden har också olika marknadsplatser förändrat sina regler för genomlysning, vilket kan tyda på att den lämpliga nivån förändras över tiden. Mycket talar därför för att den optimala utformningen av reglerna kring genomlysning varierar såväl över tiden som mellan olika marknadsplatser, olika typer av värdepapper och olika typer av investerare.

6.4 Sammanfattande bedömning

Det är ett övergripande mål för politiken inom finansmarknadsområdet att den finansiella sektorn fungerar väl och att bl.a. värdepappersinstituten och de finansiella marknaderna bidrar till en samhällsekonomiskt effektiv fördelning av kapital och risker. Detta övergripande mål kan förenas med operativa mål för systemstabilitet och konsumentskydd, som motiveras av brister i marknadsmekanismens funktion, s.k. marknadsmisslyckanden.

MiFID har samband med målet att skapa en integrerad finansiell marknad på vilken investerare åtnjuter ett effektivt skydd. Dessutom formuleras i skälen för direktivet mål för de europeiska marknadernas effektivitet och integritet, vilket avser marknadernas likviditet, kostnaden för att genomföra transaktioner och förtroendet för marknadens funktion. Detta kan tolkas som att kundskyddet visserligen skall vara effektivt, men inte så långtgående att det inverkar menligt på marknadernas funktion.

Med beaktande av effektivitetsmålet förefaller någon typ av fragmentering vara oundviklig. Effektivitet vid ett tillfälle (statisk effektivitet) gynnas av en konsoliderad marknad där alla order möts och konkurrerar med varandra. Effektivitet över tiden (dynamisk effektivitet) förutsätter emellertid konkurrens mellan handelsplatser, vilket förutsätter fragmentering av orderflödet. Konkurrens mellan order och konkurrens mellan handelsplatser kan upprätthållas på samma gång, dock inte i sina mest extrema former. Fragmentering av handeln kan ske genom internalisering av vissa order, som därmed kommer att utföras utanför

Prop. 2006/07:115

273

den reglerade marknaden, eller genom tillskapandet av alternativa handelsplatser, s.k. MTF:er. Även gränsöverskridande handel kan bidra till konkurrens och dynamisk effektivitet.

Samtidig handel i flera konkurrerande handelssystem ställer krav på god genomlysning av rådande köp- och säljintressen före handel och av genomförda transaktioner efter handel. Kravet på genomlysning skall emellertid avvägas mot behovet av kundskydd som kan variera mellan olika marknader och instrument. Kundskyddet skall alltid vara effektivt men kan vara mer långtgående när det gäller marknader som utnyttjas av mindre kunder och mindre långtgående i andra fall. Ett konkret exempel i dag är behovet av kundskydd på aktiemarknaden, som är större än motsvarande behov på exempelvis obligationsmarknaden som domineras av professionella kunder.

Oavsett marknad bör kraven på genomlysning inte drivas så långt att handel med stora poster onödigtvis försvåras, eftersom denna handel har stor betydelse för marknadens likviditet och funktion. Krav på genomlysning av stora order som ännu inte har genomförts fullt ut utgör ett incitament att flytta denna typ av handel till andra marknadsplatser som i så fall kommer i åtnjutande av den bättre funktion som de stora institutionernas handel kan medföra. Även små kunder har nytta av god likviditet och hög effektivitet i termer av liten skillnad mellan köp- och säljkurser.

Prop. 2006/07:115

274

7 Några allmänna utgångspunkter

7.1 Behöriga myndigheter

Regeringens förslag: Finansinspektionen och Bolagsverket utses till behöriga myndigheter enligt MiFID.

Utredningens förslag överensstämmer med regeringens. Remissinstanserna yttrar sig inte i frågan. Skälen för regeringens förslag: Artikel 48 i MiFID föreskriver att varje medlemsstat skall utse de behöriga myndigheter som skall fullgöra var och en av de uppgifter som anges i de olika bestämmelserna i MiFID. Varje medlemsstat skall därefter informera kommissionen och de övriga medlemsstaterna om vilka de behöriga myndigheterna är och ansvarfördelningen mellan dessa. De behöriga myndigheter som utses skall vara offentliga myndigheter.

Finansinspektionen är den myndighet i Sverige som i dag auktoriserar och har tillsyn över företag som bedriver värdepappersrörelse och marknadsplatser för finansiella instrument. Finansinspektionen har också ett internationellt kontaktnät med andra tillsynsmyndigheter vilket är av stor betydelse för att tillsynsmyndigheterna skall kunna samarbeta och bistå varandra med bl.a. det informationsutbyte som anges i artikel 49 i MiFID. Finansinspektionen bör därför i huvudsak bli den behöriga myndigheten enligt MiFID.

I avsnitt 9.2 föreslås det att värdepappersinstituten skall ansvara för att de anknutna ombuden registreras hos Bolagsverket. Detta medför att även Bolagsverket i denna del kommer att bli behörig myndighet i MiFID:s mening.

7.2 Möjligheter att delegera vissa uppgifter till annan än den behöriga myndigheten

Regeringens bedömning: De möjligheter som MiFID ger att tillåta delegation av uppgifter till annat organ än sådant som utsetts till behörig myndighet bör inte utnyttjas.

Utredningens bedömning överensstämmer med regeringens. Remissinstanserna yttrar sig inte i frågan. Skälen för regeringens bedömning: MiFID tillåter i några specifika fall delegering av vissa uppgifter, främst av administrativ, förberedande eller sidoordnad karaktär, till andra organ än de myndigheter som utsetts till behöriga myndigheter. Eventuell delegering av uppgifter får emellertid inte innefatta offentlig myndighetsutövning eller befogenhet att göra skönsmässiga bedömningar.

Från ett svenskt perspektiv skulle det ha varit en betydande fördel om utrymmet för delegation hade varit större. Bland annat skulle det i så fall ha funnits möjlighet att delegera vissa uppgifter rörande övervakning och sanktioner från Finansinspektionen till börs eller annan marknadsplats, vilket skulle har lett till klarare ansvarsförhållanden och mindre risk för

Prop. 2006/07:115

275

överlappningar. På de speciella områden där delegation är tillåten är däremot behovet av delegation av uppgifter från Finansinspektionen litet. De möjligheter som direktivet ger till sådan delegation bör därför inte utnyttjas.

7.3 En ny lag

Regeringens förslag: De nya bestämmelserna som följer av MiFID genomförs huvudsakligen i en ny lag som ersätter lagen (1991:981) om värdepappersrörelse och lagen (1992:543) om börs- och clearingverksamhet. Huvuddelen av genomförandedirektivets bestämmelser genomförs genom myndighetsföreskrifter. I de delar av genomförandeförordningen där medlemsstaterna har rätt att införa kompletterande regler ges regeringen eller underordnad myndighet föreskriftsrätt.

Utredningens förslag överensstämmer med regeringens. Remissinstanserna tillstyrker eller lämnar utan erinran förslaget om en ny lag. Riksgäldskontoret är positiva till att genomförandedirektivet genomförs genom myndighetsföreskrifter och att genomförandeförordningen, i de delar som det är tillåtet, kompletteras genom myndighetsföreskrifter, men framhåller att det är viktigt att detta sker i samverkan med marknadens aktörer.

Skälen för regeringens förslag: Huvuddelen av bestämmelserna i MiFID bör genomföras i lag. Genomförandeförordningen blir direkt gällande såsom lag i medlemsstaterna. Flertalet av förordningens bestämmelser riktar sig direkt till företagen, se t.ex. reglerna om dokumentation och kraven för att ta upp finansiella instrument till handel på en reglerad marknad. Dessa bestämmelser blir således omedelbart gällande för företagen. I andra delar innehåller förordningen definitioner och definitionsliknade bestämmelser, t.ex. om utgångspunkter för bedömningen av vilka aktier som är likvida. Förordningens bestämmelser i dessa delar avgör hur bestämmelser och begrepp i den svenska lagen skall tolkas. Slutligen ger genomförandeförordningen utrymme för nationell reglering i vissa frågor om dokumentation, transaktionsrapportering och uppskjuten publicering av stora transaktioner. Vi föreslår att regeringen eller den myndighet som regeringen bestämmer, med vissa förbehåll, ges föreskriftsrätt på dessa områden. Genomförandedirektivet bör, med något undantag, genomföras i form av föreskrifter. Förutsättningarna i genomförandedirektivet för en avvikande nationell reglering är dock snäva, (se artikel 4 i det direktivet). Vid framtagande av myndighetsföreskrifter är det naturligtvis, såsom Riksgäldskontoret påpekat, av vikt att samråd sker med marknadens aktörer.

Vid en genomgång av de olika bestämmelserna i MiFID respektive de två rättsakterna med genomförandebestämmelser framkommer att de har sin motsvarighet i den nuvarande regleringen i framför allt lagen (1991:981) om värdepappersrörelse och lagen (1992:543) om börs- och clearingverksamhet. Det är naturligt att de av MiFID påkallade bestämmelserna i så stor utsträckning som möjligt samlas i en och samma lag. Vi föreslår därför att en ny lag införs som ersätter lagen om

Prop. 2006/07:115

276

värdepappersrörelse och lagen om börs- och clearingverksamhet. Lagen bör betecknas lagen om värdepappersmarknaden.

7.4 Terminologi

Regeringens bedömning: De nya begrepp och termer som införs i samband med MiFID:s införlivande bör så nära som möjligt ansluta sig till de begrepp och termer som används i MiFID.

Utredningens bedömning överensstämmer med regeringens. Remissinstanserna: Riksgäldskontoret är positiva till att begrepp och termer i den nya lagen ansluter till dem i MiFID. Det är bra och ökar rättssäkerheten genom att vissa tolkningsfrågor kan undvikas. Juridiska fakultetsnämnden vid Stockholms universitet betonar vikten av en enhetlig terminologi i all lagstiftning avseende värdepappersmarknaden. En så enhetlig terminologi som möjligt medlemsstaterna emellan kan dock emellanåt medföra att vissa begrepp klingar obekanta. Svenska Bankföreningen och Svenska Fondhandlareföreningen anser att lagförslaget på några punkter avviker från språkbruket i direktivet men anser samtidigt att det avvikande språkbruket i flertalet fall övervägs av fördelarna med en bättre läsbarhet och tydlighet.

Skälen för regeringens bedömning: I MiFID införs en rad facktermer och begrepp, exempelvis MTF, godtagbara motparter och systematisk internhandlare, som tidigare inte förekommit i svensk lagstiftning. Vi ställs därför inför ett val att antingen anpassa vissa begrepp och termer till ett språkbruk som ligger närmare svensk lagstiftningstradition eller följa den terminologi som används i MiFID.

Eftersom MiFID kompletteras med bl.a. en direkt tillämplig genomförandeförordning, som innehåller hänvisningar till många av de begrepp som används i MiFID skulle det medföra problem att i svensk lagstiftning avvika alltför mycket från dessa begrepp. I flertalet fall bör därför den terminologi som används i lagstiftningen nära ansluta sig till MiFID:s terminologi. Så bör ske även om denna, såsom Juridiska fakultetsnämnden vid Stockholms universitet påtalat, inte alltid kan anses idealisk ur svensk språklig synvinkel. Därvid har vi också beaktat att åtminstone flertalet andra medlemsstater förefaller att ha valt att så långt möjligt ansluta sig till MiFID:s terminologi.

7.5 Förhållande mellan nationell reglering och gemenskapsregler m.m.

Regeringens bedömning: De nya bestämmelserna bör inte utan starka skäl gå längre än MiFID:s minimibestämmelser.

Utredningens bedömning överensstämmer med regeringens. Remissinstanserna stödjer bedömningen eller lämnar den utan erinran.

Skälen för regeringens bedömning: Ett viktigt syfte bakom det nya gemensamma regelverket är att uppnå en harmonisering som underlättar